Herceptin(trastuzumab)
Herceptin, Hercessi, Herwenda, Herzuma, Kanjinti, Ogivri, Ontruzant, Phesgo, Trazimera, Zercepac (trastuzumab) is an antibody pharmaceutical. Trastuzumab was first approved as Herceptin on 1998-09-25. It is used to treat breast neoplasms and gastrointestinal neoplasms in the USA. It has been approved in Europe to treat breast neoplasms and stomach neoplasms. The pharmaceutical is active against receptor tyrosine-protein kinase erbB-2.
Download report
Favorite
Events Timeline
Commercial
Clinical
Drug
Target
Variants
Financial
Trends
Safety
Events Timeline
5D
1M
3M
6M
YTD
1Y
2Y
5Y
Max
Events
FDA approval date
EMA approval date
Patent expiration date
Study first post date
Last update post date
Start date
Primary completion date
Completion date
Results first post date
Mock data
Subscribe for the real data
Subscribe for the real data
Commercial
Therapeutic Areas
Trade Name
FDA
EMA
Herceptin, Hercessi, Herzuma, Kanjinti, Ogivri, Ontruzant, Trazimera (discontinued: Herceptin)
CombinationsHerceptin hylecta, Phesgo
Drug Products
FDA
EMA
Reference product - 351(a)
Reference product - 351(a)
Interchangeable product - 351(k)
Interchangeable product - 351(k)
Biosimilar product - 351(k)
Biosimilar product - 351(k)
Trastuzumab
Hyaluronidase
+
Trastuzumab
Labels
FDA
EMA
Brand Name | Status | Last Update |
|---|---|---|
| enhertu | Biologic Licensing Application | 2025-01-28 |
| herceptin | Biologic Licensing Application | 2024-11-18 |
| herceptin hylecta | Biologic Licensing Application | 2024-11-21 |
| hercessi | Biologic Licensing Application | 2025-03-21 |
| herzuma | Biologic Licensing Application | 2025-02-12 |
| kadcyla | Biologic Licensing Application | 2024-11-18 |
| kanjinti | Biologic Licensing Application | 2024-12-20 |
| ogivri | Biologic Licensing Application | 2024-11-30 |
| ontruzant | Biologic Licensing Application | 2025-03-11 |
| ontruzant ontruzant | Biologic Licensing Application | 2024-03-01 |
Show 3 more
Indications
FDA
EMA
Agency Specific
FDA
EMA
Expiration | Code | ||
|---|---|---|---|
trastuzumab, Herceptin, Genentech, Inc. | |||
| 2117-10-20 | Orphan excl. | ||
Patent Expiration
No data
ATC Codes
L: Antineoplastic and immunomodulating agents
— L01: Antineoplastic agents
— L01F: Monoclonal antibodies and antibody drug conjugates
— L01FD: Her2 (human epidermal growth factor receptor 2) inhibitors
— L01FD01: Trastuzumab
— L01FD03: Trastuzumab emtansine
— L01FD04: Trastuzumab deruxtecan
— L01FD05: Trastuzumab duocarmazine
— L01X: Other antineoplastic agents in atc
— L01XY: Combinations of antineoplastic agents
— L01XY02: Pertuzumab and trastuzumab
HCPCS
Code | Description |
|---|---|
| J9316 | Injection, pertuzumab, trastuzumab, and hyaluronidase-zzxf, per 10 mg |
| J9354 | Injection, ado-trastuzumab emtansine, 1 mg |
| J9355 | Injection, trastuzumab, excludes biosimilar, 10 mg |
| J9356 | Injection, trastuzumab, 10 mg and hyaluronidase-oysk |
| J9358 | Injection, fam-trastuzumab deruxtecan-nxki, 1 mg |
| Q5112 | Injection, trastuzumab-dttb, biosimilar, (ontruzant), 10 mg |
| Q5113 | Injection, trastuzumab-pkrb, biosimilar, (herzuma), 10 mg |
| Q5114 | Injection, trastuzumab-dkst, biosimilar, (ogivri), 10 mg |
| Q5116 | Injection, trastuzumab-qyyp, biosimilar, (trazimera), 10 mg |
| Q5117 | Injection, trastuzumab-anns, biosimilar, (kanjinti), 10 mg |
Clinical
Clinical Trials
1547 clinical trials
View more details
Mock data
Subscribe for the real data
Subscribe for the real data
Indications Phases 4
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Breast neoplasms | D001943 | EFO_0003869 | C50 | 247 | 607 | 208 | 18 | 189 | 1152 |
| Neoplasms | D009369 | — | C80 | 86 | 74 | 10 | 3 | 26 | 176 |
| Stomach neoplasms | D013274 | EFO_0003897 | C16 | 30 | 71 | 17 | 2 | 16 | 118 |
| Neoplasm metastasis | D009362 | EFO_0009708 | — | 25 | 43 | 10 | 1 | 8 | 79 |
| Cardiotoxicity | D066126 | EFO_1001482 | — | 1 | 6 | 6 | 1 | 24 | 37 |
| Male breast neoplasms | D018567 | — | — | 11 | 20 | 2 | 1 | 4 | 34 |
| Heart failure | D006333 | EFO_0003144 | I50 | 3 | 4 | — | 1 | 3 | 10 |
| Breast diseases | D001941 | — | N60-N65 | 2 | 5 | 2 | 1 | 1 | 9 |
| Second primary neoplasms | D016609 | — | — | 1 | 4 | 1 | 1 | 2 | 9 |
| Liver neoplasms | D008113 | EFO_1001513 | C22.0 | 3 | 4 | 1 | 1 | — | 8 |
Show 2 more
Indications Phases 3
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Adenocarcinoma | D000230 | — | — | 14 | 47 | 12 | — | 9 | 72 |
| Carcinoma | D002277 | — | C80.0 | 20 | 31 | 7 | — | 1 | 53 |
| Brain neoplasms | D001932 | EFO_0003833 | C71 | 10 | 33 | 2 | — | 5 | 46 |
| Esophageal neoplasms | D004938 | — | C15 | 13 | 25 | 6 | — | 2 | 39 |
| Colorectal neoplasms | D015179 | — | — | 11 | 28 | 3 | — | 2 | 37 |
| Non-small-cell lung carcinoma | D002289 | — | — | 12 | 23 | 2 | — | 3 | 35 |
| Lung neoplasms | D008175 | — | C34.90 | 14 | 22 | 3 | — | 3 | 35 |
| Recurrence | D012008 | — | — | 11 | 12 | 5 | — | 1 | 26 |
| Triple negative breast neoplasms | D064726 | — | — | 9 | 16 | 1 | — | — | 23 |
| Ovarian neoplasms | D010051 | EFO_0003893 | C56 | 10 | 11 | 2 | — | 1 | 19 |
Show 28 more
Indications Phases 2
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Urologic neoplasms | D014571 | — | C64-C68 | 1 | 9 | — | — | — | 10 |
| Gastrointestinal neoplasms | D005770 | — | C26.9 | 3 | 5 | — | — | 1 | 9 |
| Transitional cell carcinoma | D002295 | — | — | 2 | 7 | — | — | — | 9 |
| Multiple myeloma | D009101 | — | C90.0 | 3 | 5 | — | — | 1 | 8 |
| Renal cell carcinoma | D002292 | EFO_0000376 | — | 3 | 6 | — | — | — | 8 |
| Cholangiocarcinoma | D018281 | — | C22.1 | 2 | 7 | — | — | — | 8 |
| Squamous cell carcinoma | D002294 | — | — | 3 | 6 | — | — | — | 8 |
| Sarcoma | D012509 | — | — | 3 | 5 | — | — | 2 | 8 |
| Melanoma | D008545 | — | — | 4 | 6 | — | — | — | 7 |
| Left ventricular dysfunction | D018487 | — | — | 1 | 3 | — | — | 3 | 7 |
Show 82 more
Indications Phases 1
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Healthy volunteers/patients | — | — | — | 16 | — | — | — | 2 | 18 |
| Hodgkin disease | D006689 | — | C81 | 2 | — | — | — | — | 2 |
| Carcinoid tumor | D002276 | — | D3A.00 | 2 | — | — | — | — | 2 |
| Ependymoma | D004806 | — | — | 2 | — | — | — | — | 2 |
| Myelodysplastic syndromes | D009190 | — | D46 | 1 | — | — | — | — | 1 |
| Myeloid leukemia acute | D015470 | — | C92.0 | 1 | — | — | — | — | 1 |
| Primary myelofibrosis | D055728 | — | D47.4 | 1 | — | — | — | — | 1 |
| B-cell chronic lymphocytic leukemia | D015451 | — | C91.1 | 1 | — | — | — | — | 1 |
| Bcr-abl positive chronic myelogenous leukemia | D015464 | EFO_0000340 | — | 1 | — | — | — | — | 1 |
| Myelomonocytic leukemia chronic | D015477 | — | C93.1 | 1 | — | — | — | — | 1 |
Show 47 more
Indications Without Phase
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Cardiovascular diseases | D002318 | EFO_0000319 | I98 | — | — | — | — | 5 | 5 |
| Intestinal diseases | D007410 | — | K63.9 | — | — | — | — | 4 | 4 |
| Intestinal polyps | D007417 | EFO_0003855 | — | — | — | — | — | 2 | 2 |
| Intestinal obstruction | D007415 | — | K56.60 | — | — | — | — | 2 | 2 |
| Drug therapy | D004358 | — | — | — | — | — | — | 2 | 2 |
| Inflammatory bowel diseases | D015212 | EFO_0003767 | — | — | — | — | — | 2 | 2 |
| Observation | D019370 | — | — | — | — | — | — | 1 | 1 |
| Prospective studies | D011446 | — | — | — | — | — | — | 1 | 1 |
| Chemotherapy-related cognitive impairment | D000084202 | — | — | — | — | — | — | 1 | 1 |
| Fatigue | D005221 | — | R53.83 | — | — | — | — | 1 | 1 |
Show 21 more
Epidemiology
Epidemiological information for investigational and approved indications
View more details
Drug
General
| Drug common name | Trastuzumab |
| INN | trastuzumab |
| Description | Trastuzumab, sold under the brand name Herceptin among others, is a monoclonal antibody used to treat breast cancer and stomach cancer. It is specifically used for cancer that is HER2 receptor positive. It may be used by itself or together with other chemotherapy medication. Trastuzumab is given by slow injection into a vein and injection just under the skin.
|
| Classification | Antibody |
| Drug class | monoclonal antibodies |
| Image (chem structure or protein) |  |
| Structure (InChI/SMILES or Protein Sequence) | >5U6A:A|Light Chain
DIQMTQSPILLSASVGDRVTITCRASQDVNTAVAWYQQRTNGSPRLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQP
EDEADYYCQQHYTTPPTFGAGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>5U6A:B|Heavy Chain
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQSPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAY
LQMNSLRAEDTAIYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
Target
Agency Approved
ERBB2
ERBB2
Organism
Homo sapiens
Gene name
ERBB2
Gene synonyms
HER2, MLN19, NEU, NGL
NCBI Gene ID
Protein name
receptor tyrosine-protein kinase erbB-2
Protein synonyms
c-erb B2/neu protein, CD340, herstatin, human epidermal growth factor receptor 2, Metastatic lymph node gene 19 protein, MLN 19, neuro/glioblastoma derived oncogene homolog, neuroblastoma/glioblastoma derived oncogene homolog, p185erbB2, Proto-oncogene c-ErbB-2, Proto-oncogene Neu, Tyrosine kinase-type cell surface receptor HER2, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2, v-erb-b2 avian erythroblastic leukemia viral oncoprotein 2, v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog
Uniprot ID
Mouse ortholog
Erbb2 (13866)
receptor tyrosine-protein kinase erbB-2 (Q6ZPE0)
Alternate
No data
Variants
No data
Financial
Revenue by drug
$
€
£
₣
Ontruzant – Organon
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Trazimera – Pfizer
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Herceptin – Halozyme Therapeutics
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Herceptin – Roche
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Phesgo – Roche
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Tabular view
Estimated US medical usage
No data
Trends
PubMed Central
Top Terms for Disease or Syndrome:
Mock data
Subscribe for the real data
Subscribe for the real data
Additional graphs summarizing 67,948 documents
View more details
Safety
Black-box Warning
Black-box warning for: Enhertu, Herceptin, Herceptin hylecta, Hercessi, Herzuma, Kadcyla, Kanjinti, Ogivri, Ontruzant, Ontruzant ontruzant, Phesgo, Trazimera, Trazimera-qyyp
Adverse Events
Top Adverse Reactions
Mock data
Subscribe for the real data
Subscribe for the real data
72,645 adverse events reported
View more details
© 2020-2025 Collaborative Drug Discovery Inc. (CDD) | Terms of Use