
Brand Name | Status | Last Update |
|---|---|---|
| enhertu | Biologic Licensing Application | 2025-12-23 |
| herceptin | Biologic Licensing Application | 2024-11-18 |
| herceptin hylecta | Biologic Licensing Application | 2025-12-10 |
| hercessi | Biologic Licensing Application | 2025-03-21 |
| herzuma | Biologic Licensing Application | 2025-12-22 |
| kadcyla | Biologic Licensing Application | 2025-11-21 |
| kanjinti | Biologic Licensing Application | 2025-07-11 |
| ogivri | Biologic Licensing Application | 2024-11-30 |
| ontruzant | Biologic Licensing Application | 2025-03-11 |
| ontruzant ontruzant | Biologic Licensing Application | 2024-03-01 |
Expiration | Code | ||
|---|---|---|---|
trastuzumab, Herceptin, Genentech, Inc. | |||
| 2117-10-20 | Orphan excl. | ||
Code | Description |
|---|---|
| J9316 | Injection, pertuzumab, trastuzumab, and hyaluronidase-zzxf, per 10 mg |
| J9354 | Injection, ado-trastuzumab emtansine, 1 mg |
| J9355 | Injection, trastuzumab, excludes biosimilar, 10 mg |
| J9356 | Injection, trastuzumab, 10 mg and hyaluronidase-oysk |
| J9358 | Injection, fam-trastuzumab deruxtecan-nxki, 1 mg |
| Q5112 | Injection, trastuzumab-dttb, biosimilar, (ontruzant), 10 mg |
| Q5113 | Injection, trastuzumab-pkrb, biosimilar, (herzuma), 10 mg |
| Q5114 | Injection, trastuzumab-dkst, biosimilar, (ogivri), 10 mg |
| Q5116 | Injection, trastuzumab-qyyp, biosimilar, (trazimera), 10 mg |
| Q5117 | Injection, trastuzumab-anns, biosimilar, (kanjinti), 10 mg |

Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Breast neoplasms | D001943 | EFO_0003869 | C50 | 12 | 49 | 6 | — | 6 | 68 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Neoplasms | D009369 | — | C80 | 3 | 5 | — | — | — | 8 |
| Neoplasm metastasis | D009362 | EFO_0009708 | — | 2 | 5 | — | — | 3 | 8 |
| Salivary gland neoplasms | D012468 | EFO_0003826 | D11 | — | 3 | — | — | — | 3 |
| Lung neoplasms | D008175 | — | C34.90 | 1 | 3 | — | — | — | 3 |
| Ovarian neoplasms | D010051 | EFO_0003893 | C56 | 1 | 2 | — | — | — | 3 |
| Endometrial neoplasms | D016889 | EFO_0004230 | — | 1 | 2 | — | — | — | 2 |
| Urinary bladder neoplasms | D001749 | — | C67 | — | 2 | — | — | — | 2 |
| Esophageal neoplasms | D004938 | — | C15 | — | 2 | — | — | — | 2 |
| Brain neoplasms | D001932 | EFO_0003833 | C71 | — | 2 | — | — | — | 2 |
| Triple negative breast neoplasms | D064726 | — | — | — | 2 | — | — | — | 2 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Prostatic neoplasms | D011471 | — | C61 | 1 | — | — | — | — | 1 |
| Pancreatic neoplasms | D010190 | EFO_0003860 | C25 | 1 | — | — | — | — | 1 |
| Sarcoma | D012509 | — | — | 1 | — | — | — | — | 1 |
| Healthy volunteers/patients | — | — | — | 1 | — | — | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Pregnancy | D011247 | EFO_0002950 | Z33.1 | — | — | — | — | 1 | 1 |
| Drug common name | Trastuzumab |
| INN | trastuzumab |
| Description | Trastuzumab, sold under the brand name Herceptin among others, is a monoclonal antibody used to treat breast cancer and stomach cancer. It is specifically used for cancer that is HER2 receptor positive. It may be used by itself or together with other chemotherapy medication. Trastuzumab is given by slow injection into a vein and injection just under the skin.
|
| Classification | Antibody |
| Drug class | monoclonal antibodies |
| Image (chem structure or protein) | ![]() |
| Structure (InChI/SMILES or Protein Sequence) | >5U6A:A|Light Chain
DIQMTQSPILLSASVGDRVTITCRASQDVNTAVAWYQQRTNGSPRLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQP
EDEADYYCQQHYTTPPTFGAGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>5U6A:B|Heavy Chain
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQSPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAY
LQMNSLRAEDTAIYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |

















