Therapeutic Area | MeSH |
---|---|
infections | D007239 |
Tradename | Proper name | Company | Number | Date | Products |
---|---|---|---|---|---|
Synagis | palivizumab | Orphan Medical | N-103770 RX | 2004-07-23 | 2 products |
Brand Name | Status | Last Update |
---|---|---|
synagis | Biologic Licensing Application | 2021-11-30 |
Indication | Ontology | MeSH | ICD-10 |
---|---|---|---|
respiratory syncytial virus infections | EFO_1001413 | D018357 | — |
Code | Description |
---|---|
S9562 | Home injectable therapy, palivizumab, including administrative services, professional pharmacy services, care coordination, and all necessary supplies and equipment (drugs and nursing visits coded separately), per diem |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Virus diseases | D014777 | — | B34 | — | 1 | 1 | — | 1 | 2 |
Infections | D007239 | EFO_0000544 | — | — | 1 | 1 | — | — | 1 |
Communicable diseases | D003141 | — | — | — | 1 | 1 | — | — | 1 |
Respiratory syncytial virus infections | D018357 | EFO_1001413 | — | — | 1 | 1 | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Respiratory syncytial viruses | D012136 | — | — | — | — | — | — | 1 | 1 |
Drug common name | Palivizumab |
INN | palivizumab |
Description | Immunoglobulin G 1 (human-mouse monoclonal MEDI-493y1-chain antiÂrespiratory syncytial virus protein F), disulfide with human-mouse monocional MEDI-493 x-chain, dimer |
Classification | Antibody |
Drug class | monoclonal antibodies |
Image (chem structure or protein) | ![]() |
Structure (InChI/SMILES or Protein Sequence) | >2HWZ:H|Immunoglobulin Fab heavy chain
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKDYNPSLKSRLTISKDTSANQV
VLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSSASTKGPSVFPLAPSSAAAAGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
>2HWZ:L|Immunoglobulin Fab light chain
DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPKLLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPD
DFATYYCFQGSGYPFTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |
PDB | 2HWZ |
CAS-ID | — |
RxCUI | — |
ChEMBL ID | CHEMBL1201586 |
ChEBI ID | — |
PubChem CID | — |
DrugBank | DB00110 |
UNII ID | DQ448MW7KS (ChemIDplus, GSRS) |