Therapeutic Area | MeSH |
---|---|
infections | D007239 |
Tradename | Proper name | Company | Number | Date | Products |
---|---|---|---|---|---|
Synagis | palivizumab | Orphan Medical | N-103770 RX | 2004-07-23 | 2 products |
Brand Name | Status | Last Update |
---|---|---|
synagis | Biologic Licensing Application | 2021-11-30 |
Indication | Ontology | MeSH | ICD-10 |
---|---|---|---|
respiratory syncytial virus infections | EFO_1001413 | D018357 | — |
Code | Description |
---|---|
S9562 | Home injectable therapy, palivizumab, including administrative services, professional pharmacy services, care coordination, and all necessary supplies and equipment (drugs and nursing visits coded separately), per diem |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Lung diseases | D008171 | EFO_0003818 | J98.4 | — | 1 | — | 1 | — | 2 |
Pain | D010146 | EFO_0003843 | R52 | — | — | — | 1 | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Respiratory syncytial virus infections | D018357 | EFO_1001413 | — | 1 | 3 | 6 | — | 8 | 16 |
Virus diseases | D014777 | — | B34 | — | 2 | 4 | — | 5 | 9 |
Infections | D007239 | EFO_0000544 | — | — | 2 | 3 | — | 5 | 8 |
Communicable diseases | D003141 | — | — | — | 2 | 2 | — | 4 | 6 |
Premature birth | D047928 | EFO_0003917 | O60 | — | 2 | 1 | — | 3 | 5 |
Congenital heart defects | D006330 | — | Q24.9 | — | 2 | 1 | — | 2 | 4 |
Heart diseases | D006331 | EFO_0003777 | I51.9 | — | 2 | 1 | — | 2 | 4 |
Respiratory syncytial viruses | D012136 | — | — | — | — | 1 | — | 2 | 3 |
Bronchiolitis | D001988 | — | — | 1 | — | 1 | — | — | 2 |
Bronchopulmonary dysplasia | D001997 | — | P27.8 | — | 1 | 1 | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Healthy volunteers/patients | — | — | — | 3 | — | — | — | — | 3 |
Ulcerative colitis | D003093 | EFO_0000729 | K51 | 1 | — | — | — | — | 1 |
Colitis | D003092 | EFO_0003872 | K52.9 | 1 | — | — | — | — | 1 |
Ulcer | D014456 | MPATH_579 | — | 1 | — | — | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Asthma | D001249 | EFO_0000270 | J45 | — | — | — | — | 2 | 2 |
Respiratory sounds | D012135 | — | R06.1 | — | — | — | — | 2 | 2 |
Respiratory tract infections | D012141 | — | J06.9 | — | — | — | — | 2 | 2 |
Bronchial hyperreactivity | D016535 | — | — | — | — | — | — | 1 | 1 |
Recurrence | D012008 | — | — | — | — | — | — | 1 | 1 |
Drug common name | Palivizumab |
INN | palivizumab |
Description | Immunoglobulin G 1 (human-mouse monoclonal MEDI-493y1-chain antiÂrespiratory syncytial virus protein F), disulfide with human-mouse monocional MEDI-493 x-chain, dimer |
Classification | Antibody |
Drug class | monoclonal antibodies |
Image (chem structure or protein) | ![]() |
Structure (InChI/SMILES or Protein Sequence) | >2HWZ:H|Immunoglobulin Fab heavy chain
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKDYNPSLKSRLTISKDTSANQV
VLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSSASTKGPSVFPLAPSSAAAAGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
>2HWZ:L|Immunoglobulin Fab light chain
DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPKLLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPD
DFATYYCFQGSGYPFTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |
PDB | 2HWZ |
CAS-ID | — |
RxCUI | — |
ChEMBL ID | CHEMBL1201586 |
ChEBI ID | — |
PubChem CID | — |
DrugBank | DB00110 |
UNII ID | DQ448MW7KS (ChemIDplus, GSRS) |