
Therapeutic Area | MeSH |
|---|---|
| neoplasms | D009369 |
| respiratory tract diseases | D012140 |
Tradename | Proper name | Company | Number | Date | Products |
|---|---|---|---|---|---|
| Rybrevant | amivantamab-vmjw | Johnson & Johnson | N-761210 RX | 2021-05-21 | 1 products |
Tradename | Proper name | Company | Number | Date | Products |
|---|---|---|---|---|---|
| Rybrevant Faspro | amivantamab and hyaluronidase-lpuj | Johnson & Johnson | N-761484 RX | 2026-02-13 | 4 products |
Brand Name | Status | Last Update |
|---|---|---|
| rybrevant | Biologic Licensing Application | 2025-11-11 |
| rybrevant faspro | Biologic Licensing Application | 2026-02-18 |
Indication | Ontology | MeSH | ICD-10 |
|---|---|---|---|
| non-small-cell lung carcinoma | — | D002289 | — |
| extravasation of diagnostic and therapeutic materials | — | D005119 | — |
Code | Description |
|---|---|
| J9061 | Injection, amivantamab-vmjw, 2 mg |

Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Non-small-cell lung carcinoma | D002289 | — | — | 12 | 17 | 4 | — | 4 | 31 |
| Colorectal neoplasms | D015179 | — | — | 2 | 3 | 2 | — | — | 6 |
| Squamous cell carcinoma of head and neck | D000077195 | — | — | 1 | 1 | 1 | — | — | 2 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Neoplasms | D009369 | — | C80 | 4 | 2 | — | — | — | 6 |
| Lung neoplasms | D008175 | — | C34.90 | 4 | 2 | — | — | 1 | 6 |
| Carcinoma | D002277 | — | C80.0 | 1 | 2 | — | — | — | 3 |
| Head and neck neoplasms | D006258 | — | — | 1 | 1 | — | — | — | 2 |
| Stomach neoplasms | D013274 | EFO_0003897 | C16 | — | 1 | — | — | — | 1 |
| Esophageal neoplasms | D004938 | — | C15 | — | 1 | — | — | — | 1 |
| Neoplasm metastasis | D009362 | EFO_0009708 | — | — | 1 | — | — | — | 1 |
| Salivary gland neoplasms | D012468 | EFO_0003826 | D11 | — | 1 | — | — | — | 1 |
| Adenoid cystic carcinoma | D003528 | — | — | — | 1 | — | — | — | 1 |
| Hepatocellular carcinoma | D006528 | — | C22.0 | — | 1 | — | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Brain neoplasms | D001932 | EFO_0003833 | C71 | 2 | — | — | — | — | 2 |
| Breast neoplasms | D001943 | EFO_0003869 | C50 | 1 | — | — | — | — | 1 |
| Ovarian neoplasms | D010051 | EFO_0003893 | C56 | 1 | — | — | — | — | 1 |
| Pancreatic neoplasms | D010190 | EFO_0003860 | C25 | 1 | — | — | — | — | 1 |
| Respiratory tract diseases | D012140 | — | — | 1 | — | — | — | — | 1 |
| Lung diseases | D008171 | EFO_0003818 | J98.4 | 1 | — | — | — | — | 1 |
| Respiratory tract neoplasms | D012142 | EFO_0003853 | D14 | 1 | — | — | — | — | 1 |
| Bronchogenic carcinoma | D002283 | — | — | 1 | — | — | — | — | 1 |
| Adenocarcinoma | D000230 | — | — | 1 | — | — | — | — | 1 |
| Neoplasms by histologic type | D009370 | — | — | 1 | — | — | — | — | 1 |
| Drug common name | Amivantamab |
| INN | amivantamab |
| Description | Amivantamab, sold under the brand name Rybrevant, is a bispecific monoclonal antibody used to treat non-small cell lung cancer. Amivantamab is a bispecific epidermal growth factor (EGF) receptor-directed and mesenchymal–epithelial transition (MET) receptor-directed antibody. It is the first treatment for adults with non-small cell lung cancer whose tumors have specific types of genetic mutations: epidermal growth factor receptor (EGFR) exon 20 insertion mutations.
|
| Classification | Antibody |
| Drug class | monoclonal antibodies |
| Image (chem structure or protein) | ![]() |
| Structure (InChI/SMILES or Protein Sequence) | >6WVZ:H|Heavy Chain of anti-MET Fab of amivantamab
QVQLVQSGAEVKKPGASVKVSCETSGYTFTSYGISWVRQAPGHGLEWMGWISAYNGYTNYAQKLQGRVTMTTDTSTSTAY
MELRSLRSDDTAVYYCARDLRGTNYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCHHHHHH
>6WVZ:L|Light Chain of anti-MET Fab of amivantamab
DIQMTQSPSSVSASVGDRVTITCRASQGISNWLAWFQHKPGKAPKLLIYAASSLLSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQANSFPITFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |
| PDB | 6WVZ |
| CAS-ID | 2171511-58-1 |
| RxCUI | — |
| ChEMBL ID | CHEMBL4297774 |
| ChEBI ID | — |
| PubChem CID | — |
| DrugBank | DB16695 |
| UNII ID | 0JSR7Z0NB6 (ChemIDplus, GSRS) |

