
Brand Name | Status | Last Update |
|---|---|---|
| abrilada | Biologic Licensing Application | 2025-12-22 |
| adalimumab | Biologic Licensing Application | 2025-10-28 |
| adalimumab-aacf | Biologic Licensing Application | 2026-01-08 |
| adalimumab-adbm | Biologic Licensing Application | 2025-11-12 |
| adalimumab-bwwd | Biologic Licensing Application | 2025-10-17 |
| adalimumab-ryvk | Biologic Licensing Application | 2026-01-19 |
| amjevita | Biologic Licensing Application | 2026-03-10 |
| cyltezo | Biologic Licensing Application | 2026-03-03 |
| hadlima | Biologic Licensing Application | 2025-10-17 |
| hulio | Biologic Licensing Application | 2025-02-06 |
Expiration | Code | ||
|---|---|---|---|
adalimumab, Cyltezo, Boehringer Ingelheim Pharmaceuticals, Inc. | |||
| Date TBD | Interchangeable excl. | ||
adalimumab, Humira, AbbVie Inc. | |||
| 2028-02-24 | Orphan excl. | ||
Code | Description |
|---|---|
| J0135 | Injection, adalimumab, 20 mg |

Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Rheumatoid arthritis | D001172 | EFO_0000685 | M06.9 | — | 3 | 18 | 9 | 14 | 42 |
| Psoriasis | D011565 | EFO_0000676 | L40 | 1 | 8 | 10 | 5 | 1 | 22 |
| Crohn disease | D003424 | EFO_0000384 | K50 | 1 | 4 | 14 | 2 | 4 | 22 |
| Arthritis | D001168 | EFO_0005856 | M05-M14 | — | 3 | 4 | 1 | 8 | 15 |
| Ankylosing spondylitis | D013167 | EFO_0003898 | M45 | — | 1 | 6 | 1 | 2 | 9 |
| Spondylarthritis | D025241 | — | — | — | 1 | 1 | 3 | 2 | 6 |
| Coronary artery disease | D003324 | — | I25.1 | — | — | — | 2 | — | 2 |
| Cardiovascular diseases | D002318 | EFO_0000319 | I98 | — | — | — | 1 | — | 1 |
| Obstructive sleep apnea | D020181 | EFO_0003918 | G47.33 | — | — | — | 1 | — | 1 |
| Sleep apnea syndromes | D012891 | EFO_0003877 | G47.3 | — | — | — | 1 | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Psoriatic arthritis | D015535 | EFO_0003778 | L40.5 | — | — | 3 | — | 3 | 6 |
| Ulcerative colitis | D003093 | EFO_0000729 | K51 | — | 1 | 2 | — | — | 3 |
| Juvenile arthritis | D001171 | EFO_1002007 | M08 | — | 1 | 3 | — | — | 3 |
| Uveitis | D014605 | EFO_1001231 | H20.9 | — | 2 | 2 | — | — | 2 |
| Behcet syndrome | D001528 | EFO_0003780 | M35.2 | — | — | 1 | — | — | 1 |
| Osteoarthritis | D010003 | EFO_0002506 | M15-M19 | — | — | 1 | — | — | 1 |
| Inflammation | D007249 | MP_0001845 | — | — | — | 1 | — | — | 1 |
| Mucositis | D052016 | EFO_1001898 | — | — | — | 1 | — | — | 1 |
| Inflammatory bowel diseases | D015212 | EFO_0003767 | — | — | — | 1 | — | — | 1 |
| Interstitial cystitis | D018856 | EFO_1000869 | N30.1 | — | — | 1 | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Sarcoidosis | D012507 | EFO_0000690 | D80-D89 | — | 2 | — | — | — | 2 |
| Hidradenitis suppurativa | D017497 | — | L73.2 | — | 2 | — | — | — | 2 |
| Abscess | D000038 | EFO_0003030 | — | — | 1 | — | — | — | 1 |
| Fistula | D005402 | — | — | — | 1 | — | — | — | 1 |
| Asthma | D001249 | EFO_0000270 | J45 | — | 1 | — | — | — | 1 |
| Skin diseases | D012871 | — | L00-L99 | — | 1 | — | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Spondylitis | D013166 | — | M46.9 | — | — | — | — | 2 | 2 |
| Pain | D010146 | EFO_0003843 | R52 | — | — | — | — | 1 | 1 |
| Fatigue | D005221 | — | R53.83 | — | — | — | — | 1 | 1 |
| Drug common name | Adalimumab |
| INN | adalimumab |
| Description | Adalimumab, sold under the brand name Humira among others, is a medication used to treat rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, Crohn's disease, ulcerative colitis, psoriasis, hidradenitis suppurativa, uveitis, and juvenile idiopathic arthritis. Use is generally only recommended in people who have not responded to other treatments. It is used by injection under the skin.
|
| Classification | Antibody |
| Drug class | monoclonal antibodies |
| Image (chem structure or protein) | ![]() |
| Structure (InChI/SMILES or Protein Sequence) | >6CR1:H|Heavy chain of adalimumab EFab (VH-IgE CH2)
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLY
LQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPTVKILQSICDGGGHFPPTIQLLCLVSGYTPGTI
QITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCAHHHHHH
>6CR1:L|Light chain of adalimumab EFab (VL-IgE CH2)
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQP
EDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTIQITWLEDGQVMDVD
LSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSGKKCA |
| PDB | 3WD5, 4NYL, 6CR1 |
| CAS-ID | — |
| RxCUI | — |
| ChEMBL ID | CHEMBL1201580 |
| ChEBI ID | — |
| PubChem CID | — |
| DrugBank | DB00051 |
| UNII ID | FYS6T7F842 (ChemIDplus, GSRS) |
















