Humira, Trudexa(adalimumab)
Abrilada, Amgevita, Amjevita, Amsparity, Cyltezo, Hadlima, Hefiya, Hukyndra, Hulio, Humira, Hyrimoz, Idacio, Imraldi, Libmyris, Simlandi, Yuflyma, Yusimry (adalimumab) is an antibody pharmaceutical. Adalimumab was first approved as Humira on 2002-12-31. It is used to treat ankylosing spondylitis, crohn disease, hidradenitis suppurativa, juvenile arthritis, and psoriatic arthritis amongst others in the USA. It has been approved in Europe to treat ankylosing spondylitis, arthritis, crohn disease, hidradenitis suppurativa, and papulosquamous skin diseases amongst others. The pharmaceutical is active against tumor necrosis factor.
Download report
Favorite
Events Timeline
Commercial
Clinical
Drug
Target
Variants
Financial
Trends
Safety
Events Timeline
5D
1M
3M
6M
YTD
1Y
2Y
5Y
Max
Events
FDA approval date
EMA approval date
Patent expiration date
Study first post date
Last update post date
Start date
Primary completion date
Completion date
Results first post date
Mock data
Subscribe for the real data
Subscribe for the real data
Commercial
Trade Name
FDA
EMA
Abrilada, Amjevita, Cyltezo, Hadlima, Hulio, Humira, Hyrimoz, Idacio, Simlandi, Yuflyma, Yusimry (discontinued: Abrilada, Humira, Hyrimoz)
Drug Products
FDA
EMA
Labels
FDA
EMA
Brand Name | Status | Last Update |
|---|---|---|
| abrilada | Biologic Licensing Application | 2025-01-15 |
| adalimumab | Biologic Licensing Application | 2024-12-26 |
| adalimumab-aacf | Biologic Licensing Application | 2024-08-01 |
| adalimumab-adbm | Biologic Licensing Application | 2024-05-02 |
| adalimumab-ryvk | Biologic Licensing Application | 2025-02-28 |
| amjevita | Biologic Licensing Application | 2025-01-01 |
| cyltezo | Biologic Licensing Application | 2024-05-02 |
| hadlima | Biologic Licensing Application | 2024-06-28 |
| hulio | Biologic Licensing Application | 2025-02-06 |
| humira | Biologic Licensing Application | 2024-05-16 |
Show 6 more
Indications
FDA
EMA
Agency Specific
FDA
EMA
Expiration | Code | ||
|---|---|---|---|
adalimumab, Cyltezo, Boehringer Ingelheim Pharmaceuticals, Inc. | |||
| Date TBD | Interchangeable excl. | ||
adalimumab, Humira, AbbVie Inc. | |||
| 2028-02-24 | Orphan excl. | ||
Patent Expiration
No data
HCPCS
Code | Description |
|---|---|
| J0135 | Injection, adalimumab, 20 mg |
Clinical
Clinical Trials
769 clinical trials
View more details
Mock data
Subscribe for the real data
Subscribe for the real data
Indications Phases 4
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Arthritis | D001168 | EFO_0005856 | M05-M14 | 3 | 33 | 77 | 71 | 110 | 289 |
| Rheumatoid arthritis | D001172 | EFO_0000685 | M06.9 | 4 | 26 | 58 | 67 | 94 | 246 |
| Psoriasis | D011565 | EFO_0000676 | L40 | 3 | 11 | 39 | 21 | 53 | 123 |
| Crohn disease | D003424 | EFO_0000384 | K50 | 4 | 10 | 32 | 25 | 56 | 121 |
| Spondylitis | D013166 | — | M46.9 | 1 | 3 | 17 | 19 | 42 | 81 |
| Ulcerative colitis | D003093 | EFO_0000729 | K51 | 3 | 4 | 13 | 10 | 39 | 68 |
| Spondylarthritis | D025241 | — | — | — | 3 | 16 | 18 | 32 | 68 |
| Psoriatic arthritis | D015535 | EFO_0003778 | L40.5 | 1 | 3 | 14 | 7 | 37 | 62 |
| Ankylosing spondylitis | D013167 | EFO_0003898 | M45 | 1 | 3 | 12 | 11 | 36 | 62 |
| Colitis | D003092 | EFO_0003872 | K52.9 | 1 | 4 | 13 | 7 | 24 | 49 |
Show 41 more
Indications Phases 3
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Healthy volunteers/patients | — | — | — | 28 | 1 | 1 | — | — | 29 |
| Behcet syndrome | D001528 | EFO_0003780 | M35.2 | — | 2 | 2 | — | 3 | 7 |
| Rheumatic diseases | D012216 | — | M79.0 | — | — | 2 | — | 3 | 5 |
| Osteoarthritis | D010003 | EFO_0002506 | M15-M19 | 1 | 4 | 1 | — | — | 5 |
| Pain | D010146 | EFO_0003843 | R52 | 1 | 1 | 1 | — | 2 | 4 |
| Autoimmune diseases | D001327 | EFO_0000540 | M30-M36 | 1 | 2 | 1 | — | 1 | 4 |
| Pyoderma gangrenosum | D017511 | EFO_0006835 | L88 | — | 2 | 1 | — | 1 | 4 |
| Pyoderma | D011711 | — | L08.0 | — | 2 | 1 | — | 1 | 4 |
| Enthesopathy | D000070676 | — | M77.9 | — | — | 2 | — | 1 | 3 |
| Non-radiographic axial spondyloarthritis | D000089202 | — | M45.A | — | — | 1 | — | 2 | 3 |
Show 15 more
Indications Phases 2
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Syndrome | D013577 | — | — | — | 3 | — | — | 1 | 4 |
| Sarcoidosis | D012507 | EFO_0000690 | D80-D89 | — | 4 | — | — | — | 4 |
| Focal segmental glomerulosclerosis | D005923 | EFO_0004236 | — | 1 | 2 | — | — | — | 3 |
| Choroidal neovascularization | D020256 | — | — | 1 | 1 | — | — | — | 2 |
| Pathologic neovascularization | D009389 | — | — | 1 | 1 | — | — | — | 2 |
| Mucopolysaccharidosis vi | D009087 | — | — | 2 | 2 | — | — | — | 2 |
| Mucopolysaccharidoses | D009083 | — | E76.3 | 2 | 2 | — | — | — | 2 |
| Mucopolysaccharidosis i | D008059 | — | E76.0 | 2 | 2 | — | — | — | 2 |
| Mucopolysaccharidosis ii | D016532 | — | E76.1 | 2 | 2 | — | — | — | 2 |
| Tuberculosis | D014376 | EFO_0000774 | A15-A19 | — | 1 | — | — | 1 | 2 |
Show 23 more
Indications Phases 1
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Retinal diseases | D012164 | — | H35.9 | 1 | — | — | — | 1 | 2 |
| Melanoma | D008545 | — | — | 1 | — | — | — | — | 1 |
| Uveal neoplasms | D014604 | EFO_1001230 | — | 1 | — | — | — | — | 1 |
| Immune system diseases | D007154 | — | D89.9 | 1 | — | — | — | — | 1 |
| Therapeutic equivalency | D013810 | — | — | 1 | — | — | — | — | 1 |
| Thyroid neoplasms | D013964 | EFO_0003841 | — | 1 | — | — | — | — | 1 |
| Anaplastic thyroid carcinoma | D065646 | — | — | 1 | — | — | — | — | 1 |
| Thyroid diseases | D013959 | — | E00-E07 | 1 | — | — | — | — | 1 |
| Innate immunity | D007113 | — | — | 1 | — | — | — | — | 1 |
| Diabetic retinopathy | D003930 | EFO_0003770 | — | 1 | — | — | — | — | 1 |
Indications Without Phase
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Fatigue | D005221 | — | R53.83 | — | — | — | — | 2 | 2 |
| Depression | D003863 | — | F33.9 | — | — | — | — | 2 | 2 |
| Infections | D007239 | EFO_0000544 | — | — | — | — | — | 2 | 2 |
| Anxiety disorders | D001008 | EFO_0006788 | F41.1 | — | — | — | — | 2 | 2 |
| Anxiety | D001007 | EFO_0005230 | F41.1 | — | — | — | — | 2 | 2 |
| Collagen diseases | D003095 | — | — | — | — | — | — | 2 | 2 |
| Drug monitoring | D016903 | — | — | — | — | — | — | 2 | 2 |
| Autism spectrum disorder | D000067877 | — | F84.0 | — | — | — | — | 2 | 2 |
| Uveomeningoencephalitic syndrome | D014607 | Orphanet_3437 | H20.82 | — | — | — | — | 2 | 2 |
| Brain diseases | D001927 | — | G93.40 | — | — | — | — | 1 | 1 |
Show 27 more
Epidemiology
Epidemiological information for investigational and approved indications
View more details
Drug
General
| Drug common name | Adalimumab |
| INN | adalimumab |
| Description | Adalimumab, sold under the brand name Humira among others, is a medication used to treat rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, Crohn's disease, ulcerative colitis, psoriasis, hidradenitis suppurativa, uveitis, and juvenile idiopathic arthritis. Use is generally only recommended in people who have not responded to other treatments. It is used by injection under the skin.
|
| Classification | Antibody |
| Drug class | monoclonal antibodies |
| Image (chem structure or protein) |  |
| Structure (InChI/SMILES or Protein Sequence) | >6CR1:H|Heavy chain of adalimumab EFab (VH-IgE CH2)
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLY
LQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPTVKILQSICDGGGHFPPTIQLLCLVSGYTPGTI
QITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCAHHHHHH
>6CR1:L|Light chain of adalimumab EFab (VL-IgE CH2)
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQP
EDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTIQITWLEDGQVMDVD
LSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSGKKCA |
Identifiers
| PDB | 3WD5, 4NYL, 6CR1 |
| CAS-ID | — |
| RxCUI | — |
| ChEMBL ID | CHEMBL1201580 |
| ChEBI ID | — |
| PubChem CID | — |
| DrugBank | DB00051 |
| UNII ID | FYS6T7F842 (ChemIDplus, GSRS) |
Target
Agency Approved
TNF
TNF
Organism
Homo sapiens
Gene name
TNF
Gene synonyms
TNFA, TNFSF2
NCBI Gene ID
Protein name
tumor necrosis factor
Protein synonyms
APC1 protein, Cachectin, TNF, macrophage-derived, TNF, monocyte-derived, TNF-a, TNF-alpha, tumor necrosis factor ligand 1F, Tumor necrosis factor ligand superfamily member 2, tumor necrosis factor-alpha, tumor necrotic factor alpha
Uniprot ID
Mouse ortholog
Tnf (21926)
tumor necrosis factor (P06804)
Alternate
No data
Variants
No data
Financial
Revenue by drug
$
€
£
₣
Yusimry – Coherus BioSciences
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Humira – AbbVie
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Humira – Alvotech
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Hadlima – Organon
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Imraldi – Biogen
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Tabular view
Estimated US medical usage
Adalimumab
Total medical expenditures per year (USD, in millions)
Mock data
Subscribe for the real data
Subscribe for the real data
Number of persons purchased
Mock data
Subscribe for the real data
Subscribe for the real data
Number of purchases
Mock data
Subscribe for the real data
Subscribe for the real data
Refill frequency
Mock data
Subscribe for the real data
Subscribe for the real data
Price per prescription (USD)
Mock data
Subscribe for the real data
Subscribe for the real data
Tabular view
Trends
PubMed Central
Top Terms for Disease or Syndrome:
Mock data
Subscribe for the real data
Subscribe for the real data
Additional graphs summarizing 33,380 documents
View more details
Safety
Black-box Warning
Black-box warning for: Abrilada, Adalimumab, Adalimumab-aacf, Adalimumab-adbm, Adalimumab-ryvk, Amjevita, Cyltezo, Hadlima, Hulio, Humira, Hyrimoz, Idacio, Simlandi, Yuflyma, Yusimry
Adverse Events
Top Adverse Reactions
Mock data
Subscribe for the real data
Subscribe for the real data
706,831 adverse events reported
View more details
© 2020-2025 Collaborative Drug Discovery Inc. (CDD) | Terms of Use