
Tradename | Proper name | Company | Number | Date | Products |
|---|---|---|---|---|---|
| Stelara | ustekinumab | Johnson & Johnson | N-125261 RX | 2009-09-25 | 3 products |
| Stelara | ustekinumab | Johnson & Johnson | N-761044 RX | 2016-09-23 | 1 products |
Brand Name | Status | Last Update |
|---|---|---|
| imuldosa | Biologic Licensing Application | 2026-01-27 |
| otulfi | Biologic Licensing Application | 2025-12-19 |
| pyzchiva | Biologic Licensing Application | 2025-12-09 |
| selarsdi | Biologic Licensing Application | 2025-12-03 |
| starjemza | Biologic Licensing Application | 2025-10-24 |
| stelara | Biologic Licensing Application | 2026-01-28 |
| steqeyma | Biologic Licensing Application | 2025-04-21 |
| ustekinumab | Biologic Licensing Application | 2026-01-23 |
| ustekinumab-aauz | Biologic Licensing Application | 2025-12-18 |
| ustekinumab-aekn | Biologic Licensing Application | 2026-01-05 |

Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Crohn disease | D003424 | EFO_0000384 | K50 | 2 | 3 | 7 | 1 | 4 | 16 |
| Psoriasis | D011565 | EFO_0000676 | L40 | 1 | — | 7 | 2 | 5 | 15 |
| Cardiovascular diseases | D002318 | EFO_0000319 | I98 | — | — | — | 1 | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Psoriatic arthritis | D015535 | EFO_0003778 | L40.5 | — | 1 | 3 | — | 6 | 10 |
| Ulcerative colitis | D003093 | EFO_0000729 | K51 | 1 | — | 3 | — | 2 | 6 |
| Colitis | D003092 | EFO_0003872 | K52.9 | 1 | — | 4 | — | — | 5 |
| Inflammatory bowel diseases | D015212 | EFO_0003767 | — | — | — | 4 | — | — | 4 |
| Systemic lupus erythematosus | D008180 | EFO_0002690 | M32 | — | 1 | 2 | — | — | 3 |
| Ankylosing spondylitis | D013167 | EFO_0003898 | M45 | — | — | 2 | — | 1 | 3 |
| Axial spondyloarthritis | D000089183 | — | — | — | — | 3 | — | — | 3 |
| Skin diseases | D012871 | — | L00-L99 | — | — | 1 | — | 1 | 2 |
| Ulcer | D014456 | MPATH_579 | — | 1 | — | 1 | — | — | 2 |
| Spondylitis | D013166 | — | M46.9 | — | — | 1 | — | 1 | 2 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Rheumatoid arthritis | D001172 | EFO_0000685 | M06.9 | — | 1 | — | — | 1 | 2 |
| Biliary liver cirrhosis | D008105 | — | K74.3 | — | 1 | — | — | — | 1 |
| Neoplasms | D009369 | — | C80 | — | 1 | — | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Healthy volunteers/patients | — | — | — | 3 | — | — | — | — | 3 |
| Ichthyosis | D007057 | — | E50.8 | 1 | — | — | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Arthritis | D001168 | EFO_0005856 | M05-M14 | — | — | — | — | 4 | 4 |
| Congenital abnormalities | D000013 | EFO_0003915 | Q89.9 | — | — | — | — | 1 | 1 |
| Autoimmune diseases | D001327 | EFO_0000540 | M30-M36 | — | — | — | — | 1 | 1 |
| Pregnancy | D011247 | EFO_0002950 | Z33.1 | — | — | — | — | 1 | 1 |
| Necrosis | D009336 | — | — | — | — | — | — | 1 | 1 |
| Drug common name | Ustekinumab |
| INN | ustekinumab |
| Description | Ustekinumab, sold under the brand name Stelara, is a human monoclonal antibody used to treat psoriasis. It is also approved to treat Crohn's disease in the United States, Israel and Australia, and ulcerative colitis in the U.S., and in the European Union (EU) among people who have not responded to more traditional treatments. |
| Classification | Antibody |
| Drug class | monoclonal antibodies |
| Image (chem structure or protein) | ![]() |
| Structure (InChI/SMILES or Protein Sequence) | >3HMW:H|USTEKINUMAB FAB HEAVY CHAIN
EVQLVQSGAEVKKPGESLKISCKGSGYSFTTYWLGWVRQMPGKGLDWIGIMSPVDSDIRYSPSFQGQVTMSVDKSITTAY
LQWNSLKASDTAMYYCARRRPGQGYFDFWGQGTLVTVSSSSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
>3HMW:L|USTEKINUMAB FAB LIGHT CHAIN
DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQYNIYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |
| PDB | 3HMW, 3HMX |
| CAS-ID | — |
| RxCUI | — |
| ChEMBL ID | CHEMBL1201835 |
| ChEBI ID | — |
| PubChem CID | — |
| DrugBank | DB05679 |
| UNII ID | FU77B4U5Z0 (ChemIDplus, GSRS) |



