
Brand Name | Status | Last Update |
|---|---|---|
| riabni | Biologic Licensing Application | 2025-09-12 |
| rituxan | Biologic Licensing Application | 2025-01-06 |
| rituxan hycela | Biologic Licensing Application | 2025-12-15 |
| ruxience | Biologic Licensing Application | 2025-06-18 |
| truxima | Biologic Licensing Application | 2025-06-18 |
Expiration | Code | ||
|---|---|---|---|
rituximab, Rituxan, Genentech, Inc. | |||
| 2026-09-27 | Orphan excl. | ||
rituximab / hyaluronidase human, Rituxan Hycela, Genentech, Inc. | |||
| 2024-06-22 | Orphan excl. | ||

Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Lymphoma | D008223 | — | C85.9 | 2 | 7 | 1 | — | 1 | 9 |
| Large b-cell lymphoma diffuse | D016403 | — | C83.3 | 2 | 4 | 3 | — | 1 | 9 |
| Non-hodgkin lymphoma | D008228 | — | C85.9 | 2 | 5 | 1 | — | 2 | 8 |
| Vasculitis | D014657 | EFO_0006803 | M31 | — | 2 | 2 | — | — | 4 |
| Anti-neutrophil cytoplasmic antibody-associated vasculitis | D056648 | — | I77.82 | — | 1 | 1 | — | — | 2 |
| Rheumatoid arthritis | D001172 | EFO_0000685 | M06.9 | — | — | 1 | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| B-cell lymphoma | D016393 | — | — | 1 | 4 | — | — | — | 4 |
| Mantle-cell lymphoma | D020522 | — | C83.1 | 1 | 1 | — | — | 1 | 2 |
| Neutropenia | D009503 | — | D70 | — | 1 | — | — | — | 1 |
| Reactive arthritis | D016918 | EFO_0007460 | M02.3 | — | 1 | — | — | — | 1 |
| Recurrence | D012008 | — | — | 1 | 1 | — | — | — | 1 |
| B-cell lymphoma marginal zone | D018442 | — | C88.4 | 1 | 1 | — | — | — | 1 |
| Burkitt lymphoma | D002051 | — | C83.7 | 1 | 1 | — | — | — | 1 |
| Waldenstrom macroglobulinemia | D008258 | — | C88.0 | — | 1 | — | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Precursor cell lymphoblastic leukemia-lymphoma | D054198 | — | C91.0 | 1 | — | — | — | — | 1 |
| Transplantation | D014180 | — | — | 1 | — | — | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| T-cell lymphoma peripheral | D016411 | — | — | — | — | — | — | 1 | 1 |
| Drug common name | Rituximab |
| INN | rituximab |
| Description | Rituximab, sold under the brand name Rituxan among others, is a medication used to treat certain autoimmune diseases and types of cancer. It is used for non-Hodgkin lymphoma, chronic lymphocytic leukemia, rheumatoid arthritis, granulomatosis with polyangiitis, idiopathic thrombocytopenic purpura, pemphigus vulgaris, myasthenia gravis and Epstein–Barr virus-positive mucocutaneous ulcers. It is given by slow injection into a vein.
|
| Classification | Antibody |
| Drug class | monoclonal antibodies: chimeric, tumors as target |
| Image (chem structure or protein) | ![]() |
| Structure (InChI/SMILES or Protein Sequence) | >1L6X:A|IMMUNOGLOBULIN GAMMA-1 HEAVY CHAIN CONSTANT REGION
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
>1L6X:B|Minimized B-domain of Protein A Z34C
FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC |
| PDB | 1L6X, 2OSL, 4KAQ, 6VJA, 6Y90 |
| CAS-ID | — |
| RxCUI | — |
| ChEMBL ID | CHEMBL1201576 |
| ChEBI ID | — |
| PubChem CID | — |
| DrugBank | DB00073 |
| UNII ID | 4F4X42SYQ6 (ChemIDplus, GSRS) |






