Onabotulinumtoxina
Botox (onabotulinumtoxina) is an unknown pharmaceutical. Onabotulinumtoxina was first approved as Botox cosmetic on 1991-12-09. It is used to treat blepharospasm, dystonia, fissure in ano, genetic skin diseases, and hyperhidrosis amongst others in the USA.
Download report
Favorite
Events Timeline
Commercial
Clinical
Drug
Target
Variants
Financial
Trends
Safety
Events Timeline
5D
1M
3M
6M
YTD
1Y
2Y
5Y
Max
Events
FDA approval date
EMA approval date
Patent expiration date
Study first post date
Last update post date
Start date
Primary completion date
Completion date
Results first post date
Mock data
Subscribe for the real data
Subscribe for the real data
Commercial
Therapeutic Areas
Trade Name
FDA
EMA
Botox (discontinued: Botox)
Drug Products
FDA
EMA
Reference product - 351(a)
Reference product - 351(a)
Interchangeable product - 351(k)
Interchangeable product - 351(k)
Biosimilar product - 351(k)
Biosimilar product - 351(k)
Labels
FDA
EMA
Brand Name | Status | Last Update |
|---|---|---|
| babybig | Biologic Licensing Application | 2021-06-30 |
| botox | Biologic Licensing Application | 2023-11-18 |
| botox cosmetic | Biologic Licensing Application | 2024-10-18 |
| botox facial serum | C200263 | 2024-10-28 |
| botox serum | C200263 | 2024-11-03 |
| botox stock solution | C200263 | 2024-11-03 |
| botox stock solution anti-aging serum | C200263 | 2024-10-12 |
| botulinum toxin solution anti-aging serum | C200263 | 2024-10-21 |
| daxxify | Biologic Licensing Application | 2024-01-24 |
| dysport | Biologic Licensing Application | 2024-10-24 |
Show 1 more
Indications
FDA
EMA
Agency Specific
FDA
EMA
Expiration | Code | ||
|---|---|---|---|
onabotulinumtoxina, Botox , AbbVie Inc. | |||
| 2026-06-20 | Orphan excl. | ||
onabotulinumtoxina, Botox Cosmetic, AbbVie Inc. | |||
| 2026-06-20 | Orphan excl. | ||
Patent Expiration
No data
ATC Codes
No data
HCPCS
Code | Description |
|---|---|
| J0585 | Injection, onabotulinumtoxina, 1 unit |
Clinical
Clinical Trials
1365 clinical trials
View more details
Mock data
Subscribe for the real data
Subscribe for the real data
Indications Phases 4
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Muscle spasticity | D009128 | HP_0001257 | — | 9 | 19 | 48 | 26 | 82 | 175 |
| Overactive urinary bladder | D053201 | EFO_1000781 | N32.81 | 8 | 18 | 26 | 27 | 36 | 109 |
| Stroke | D020521 | EFO_0000712 | I63.9 | 5 | 11 | 29 | 15 | 43 | 98 |
| Cerebral palsy | D002547 | — | G80 | 3 | 11 | 22 | 7 | 53 | 91 |
| Dystonia | D004421 | HP_0001332 | G24 | 7 | 15 | 15 | 12 | 37 | 80 |
| Dystonic disorders | D020821 | — | G24 | 7 | 14 | 15 | 9 | 33 | 72 |
| Torticollis | D014103 | HP_0000473 | F45.8 | 6 | 12 | 13 | 12 | 27 | 68 |
| Migraine disorders | D008881 | EFO_0003821 | G43 | 3 | 9 | 15 | 14 | 25 | 63 |
| Syndrome | D013577 | — | — | 12 | 24 | 10 | 6 | 9 | 53 |
| Urinary incontinence | D014549 | HP_0000020 | R32 | 4 | 7 | 15 | 12 | 10 | 44 |
Show 150 more
Indications Phases 3
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Sialorrhea | D012798 | HP_0002307 | K11.7 | — | 5 | 9 | — | 2 | 13 |
| Traumatic brain injuries | D000070642 | — | S06 | — | 4 | 5 | — | 3 | 11 |
| Equinus deformity | D004863 | — | — | — | 1 | 1 | — | 8 | 10 |
| Lower urinary tract symptoms | D059411 | EFO_0008008 | — | 1 | 2 | 1 | — | 5 | 9 |
| Atrial fibrillation | D001281 | EFO_0000275 | I48.0 | 2 | 7 | 2 | — | — | 9 |
| Talipes | D000070558 | HP_0001883 | Q66.1 | — | 1 | 1 | — | 7 | 9 |
| Tennis elbow | D013716 | EFO_1001896 | M77.1 | — | — | 5 | — | 3 | 8 |
| Ganglion cysts | D045888 | — | M67.4 | 2 | 4 | 2 | — | 1 | 7 |
| Vulvodynia | D056650 | — | N94.81 | — | 2 | 3 | — | 2 | 7 |
| Erectile dysfunction | D007172 | EFO_0004234 | F52.21 | 2 | 5 | 3 | — | — | 6 |
Show 58 more
Indications Phases 2
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Muscle cramp | D009120 | HP_0003394 | — | 1 | 3 | — | — | 3 | 6 |
| Esophageal motility disorders | D015154 | — | K22.4 | — | 1 | — | — | 3 | 4 |
| Myalgia | D063806 | HP_0003326 | M79.1 | — | 1 | — | — | 2 | 3 |
| Abdominal hernia | D046449 | — | K46 | — | 1 | — | — | 2 | 3 |
| Internal hernia | D000082122 | — | — | — | 1 | — | — | 2 | 3 |
| Peripheral nervous system diseases | D010523 | HP_0009830 | G64 | — | 1 | — | — | 2 | 3 |
| Diabetes mellitus | D003920 | HP_0000819 | E08-E13 | — | 1 | — | — | 2 | 3 |
| Neck pain | D019547 | HP_0030833 | M54.2 | 2 | 1 | — | — | 1 | 3 |
| Carpal tunnel syndrome | D002349 | EFO_0004143 | G56.0 | — | 3 | — | — | — | 3 |
| Ventral hernia | D006555 | EFO_1001866 | K43 | — | 1 | — | — | 1 | 2 |
Show 77 more
Indications Phases 1
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Neurologic gait disorders | D020233 | HP_0003376 | R26.1 | 1 | — | — | — | 2 | 3 |
| Hemorrhagic stroke | D000083302 | — | — | 1 | — | — | — | 2 | 3 |
| Complex regional pain syndromes | D020918 | EFO_1001998 | — | 1 | — | — | — | 2 | 3 |
| Reflex sympathetic dystrophy | D012019 | EFO_1001147 | G90.5 | 1 | — | — | — | 2 | 3 |
| Skin abnormalities | D012868 | HP_0000951 | Q82.9 | 1 | — | — | — | 1 | 2 |
| Parkinsonian disorders | D020734 | HP_0001300 | G20.C | 1 | — | — | — | 1 | 2 |
| Intracranial sinus thrombosis | D012851 | — | — | 1 | — | — | — | — | 1 |
| Internal carotid artery dissection | D020215 | — | — | 1 | — | — | — | — | 1 |
| Vertebral artery dissection | D020217 | — | I77.74 | 1 | — | — | — | — | 1 |
| Vascular headaches | D014653 | — | — | 1 | — | — | — | — | 1 |
Show 14 more
Indications Without Phase
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Diffuse esophageal spasm | D015155 | EFO_1001785 | K22.4 | — | — | — | — | 3 | 3 |
| Ultrasonography | D014463 | — | — | — | — | — | — | 2 | 2 |
| Ischemic stroke | D000083242 | — | — | — | — | — | — | 2 | 2 |
| Flushing | D005483 | — | R23.2 | — | — | — | — | 2 | 2 |
| Movement disorders | D009069 | HP_0100022 | — | — | — | — | — | 2 | 2 |
| Activities of daily living | D000203 | — | — | — | — | — | — | 1 | 1 |
| Pancreatectomy | D010180 | EFO_0002581 | — | — | — | — | — | 1 | 1 |
| Treatment outcome | D016896 | — | — | — | — | — | — | 1 | 1 |
| Muscle tonus | D009129 | — | — | — | — | — | — | 1 | 1 |
| Gastroesophageal reflux | D005764 | EFO_0003948 | K21 | — | — | — | — | 1 | 1 |
Show 57 more
Epidemiology
Epidemiological information for investigational and approved indications
View more details
Drug
General
| Drug common name | Onabotulinumtoxina |
| INN | — |
| Description | Botulinum neurotoxin type A precursor (BoNT/A) (Bontoxilysin A) |
| Classification | Neurotoxin |
| Drug class | cannabinol derivatives |
| Image (chem structure or protein) |  |
| Structure (InChI/SMILES or Protein Sequence) | >2VU9:A|BOTULINUM NEUROTOXIN A HEAVY CHAIN
MGSSHHHHHHSSGLVPRGSHMDTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIV
YNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINR
WIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSN
SGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNI
VRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFH
QFNNIAKLVASNWYNRQIERSSRTLGCSWEFIPVDDGWGERPLQ |
Identifiers
| PDB | 2G7P, 2VU9, 2VUA, 3BTA, 3DDA, 3DDB, 3DS9, 3DSE, 3FUO, 3K3Q, 3QIX, 3QIY, 3QIZ, 3QJ0, 3QW5, 3QW6, 3QW7, 3QW8, 3ZUR, 3ZUS, 4EJ5, 4EL4, 4ELC, 4HEV, 4IQP, 4JRA, 4KS6, 4KTX, 4KUF, 4ZJX, 5JLV, 5JMC, 5L21, 5MK6, 5MK7, 5MOY, 5TPB, 5TPC, 5V8P, 5V8R, 5V8U, 5VGV, 5VGX, 6DKK, 6ES1, 6MHJ, 6XCB, 6XCC, 6XCD, 6XCE, 6XCF, 7N18 |
| CAS-ID | — |
| RxCUI | — |
| ChEMBL ID | CHEMBL1201574 |
| ChEBI ID | — |
| PubChem CID | — |
| DrugBank | DB00083 |
| UNII ID | — |
Target
No data
Variants
No data
Financial
Revenue by drug
$
€
£
â‚£
Botox – Allergan
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Botox – Warner Chilcott
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Tabular view
Estimated US medical usage
Onabotulinumtoxina
Total medical expenditures per year (USD, in millions)
Mock data
Subscribe for the real data
Subscribe for the real data
Number of persons purchased
Mock data
Subscribe for the real data
Subscribe for the real data
Number of purchases
Mock data
Subscribe for the real data
Subscribe for the real data
Refill frequency
Mock data
Subscribe for the real data
Subscribe for the real data
Price per prescription (USD)
Mock data
Subscribe for the real data
Subscribe for the real data
Tabular view
Trends
PubMed Central
Top Terms for Disease or Syndrome:
Mock data
Subscribe for the real data
Subscribe for the real data
Additional graphs summarizing 9,058 documents
View more details
Safety
Black-box Warning
Black-box warning for: Botox, Botox cosmetic, Daxxify, Dysport
Adverse Events
Top Adverse Reactions
Mock data
Subscribe for the real data
Subscribe for the real data
76,192 adverse events reported
View more details
© 2020-2024 Collaborative Drug Discovery Inc. (CDD) | Terms of Use