PharmaKB logo
Company Reports
Company Reports
Drug Reports
Drug Reports
Disease Reports
Disease Reports
AboutPricing
Drug ReportsIxekizumab
Taltz(ixekizumab)
Taltz (ixekizumab) is an antibody pharmaceutical. Ixekizumab was first approved as Taltz on 2016-03-22. It is used to treat psoriasis in the USA. It has been approved in Europe to treat psoriasis. The pharmaceutical is active against interleukin-17A.
Download report
Favorite
Top 200 Pharmaceuticals by Retail Sales
Events Timeline
Commercial
Clinical
Drug
Target
Variants
Financial
Trends
Safety
Events Timeline
5D
1M
3M
6M
YTD
1Y
2Y
5Y
Max
Events
FDA approval date
EMA approval date
Patent expiration date
Study first post date
Last update post date
Start date
Primary completion date
Completion date
Results first post date
Plot placeholder
Mock data
Subscribe for the real data
Commercial
Therapeutic Areas
Therapeutic Area
MeSH
skin and connective tissue diseasesD017437
Trade Name
FDA
EMA
Taltz
Drug Products
FDA
EMA
Reference product - 351(a)
Reference product - 351(a)
Interchangeable product - 351(k)
Interchangeable product - 351(k)
Biosimilar product - 351(k)
Biosimilar product - 351(k)
Ixekizumab
Tradename
Proper name
Company
Number
Date
Products
TaltzixekizumabEli LillyN-125521 RX2016-03-22
4 products
Labels
FDA
EMA
Brand Name
Status
Last Update
taltzBiologic Licensing Application2024-11-13
Indications
FDA
EMA
Indication
Ontology
MeSH
ICD-10
psoriasisEFO_0000676D011565L40
Agency Specific
FDA
EMA
No data
Patent Expiration
No data
ATC Codes
L: Antineoplastic and immunomodulating agents
— L04: Immunosuppressants
— L04A: Immunosuppressants
— L04AC: Interleukin inhibitors
— L04AC13: Ixekizumab
HCPCS
No data
Clinical
Clinical Trials
72 clinical trials
View more details
Plot placeholder
Mock data
Subscribe for the real data
Indications Phases 4
Indication
MeSH
Ontology
ICD-10
Ph 1
Ph 2
Ph 3
Ph 4
Other
Total
PsoriasisD011565EFO_0000676L4021135122
Psoriatic arthritisD015535EFO_0003778L40.5——4419
ArthritisD001168EFO_0005856M05-M14213219
SpondylarthritisD025241————51—6
SpondylitisD013166—M46.9——41—5
Rheumatoid arthritisD001172EFO_0000685M06.921—1—4
ObesityD009765EFO_0001073E66.9——22—4
OverweightD050177—E66.3———2—2
UveitisD014605EFO_1001231H20.9———1—1
Intermediate uveitisD015867EFO_1000986————1—1
Show 4 more
Indications Phases 3
Indication
MeSH
Ontology
ICD-10
Ph 1
Ph 2
Ph 3
Ph 4
Other
Total
Axial spondyloarthritisD000089183————4——4
Ankylosing spondylitisD013167EFO_0003898M45——2——2
Juvenile arthritisD001171EFO_1002007M08——1——1
Non-radiographic axial spondyloarthritisD000089202—M45.A——1——1
Indications Phases 2
Indication
MeSH
Ontology
ICD-10
Ph 1
Ph 2
Ph 3
Ph 4
Other
Total
Pityriasis rubra pilarisD010916—L44.0—1———1
Exfoliative dermatitisD003873—L26—1———1
PityriasisD010915———1———1
Pyoderma gangrenosumD017511EFO_0006835L88—1———1
PyodermaD011711—L08.0—1———1
Bullous pemphigoidD010391EFO_0007187L12—1———1
Indications Phases 1
Indication
MeSH
Ontology
ICD-10
Ph 1
Ph 2
Ph 3
Ph 4
Other
Total
Healthy volunteers/patients———4————4
Indications Without Phase
No data
Epidemiology
Epidemiological information for investigational and approved indications
View more details
Drug
General
Drug common nameIxekizumab
INNixekizumab
Description
Ixekizumab (humanized mab)
Classification
Antibody
Drug classmonoclonal antibodies
Image (chem structure or protein)Loading
Structure (InChI/SMILES or Protein Sequence)
>6NOV:A,C|Fab Heavy Chain QVQLVQSGAEVKKPGSSVKVSCKASGYSFTDYHIHWVRQAPGQGLEWMGVINPMYGTTDYNQRFKGRVTITADESTSTAY MELSSLRSEDTAVYYCARYDYFTGTGVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH >6NOV:B,D|Fab Light Chain DIVMTQTPLSLSVTPGQPASISCRSSRSLVHSRGNTYLHWYLQKPGQSPQLLIYKVSNRFIGVPDRFSGSGSGTDFTLKI SRVEAEDVGVYYCSQSTHLPFTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Identifiers
PDB6NOU, 6NOV
CAS-ID—
RxCUI—
ChEMBL IDCHEMBL1743034
ChEBI ID—
PubChem CID—
DrugBankDB11569
UNII IDBTY153760O (ChemIDplus, GSRS)
Target
Agency Approved
IL17A
IL17A
Organism
Homo sapiens
Gene name
IL17A
Gene synonyms
CTLA8, IL17
NCBI Gene ID
Protein name
interleukin-17A
Protein synonyms
CTLA-8, Cytotoxic T-lymphocyte-associated antigen 8, cytotoxic T-lymphocyte-associated protein 8, interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8), interleukin-17
Uniprot ID
Mouse ortholog
Il17a (16171)
interleukin-17A (Q62386)
Alternate
No data
Variants
No data
Financial
Revenue by drug
$
€
£
â‚£
Taltz – Eli Lilly
Plot placeholder
Mock data
Subscribe for the real data
Plot placeholder
Mock data
Subscribe for the real data
Tabular view
Estimated US medical usage
No data
Trends
PubMed Central
Top Terms for Disease or Syndrome:
Plot placeholder
Mock data
Subscribe for the real data
Additional graphs summarizing 4,761 documents
View more details
Safety
Black-box Warning
No Black-box warning
Adverse Events
Top Adverse Reactions
Plot placeholder
Mock data
Subscribe for the real data
33,182 adverse events reported
View more details
© 2020-2025 Collaborative Drug Discovery Inc. (CDD) | Terms of Use