Tradename | Proper name | Company | Number | Date | Products |
---|---|---|---|---|---|
Zymfentra | infliximab-dyyb | Celltrion | N-761358 RX | 2023-10-20 | 2 products |
Remicade | infliximab | Johnson & Johnson | N-103772 RX | 1998-08-24 | 1 products |
Brand Name | Status | Last Update |
---|---|---|
avsola | Biologic Licensing Application | 2025-05-08 |
ca22 benzoyl peroxide cleansing | OTC monograph final | 2022-12-08 |
inflectra | Biologic Licensing Application | 2024-08-30 |
infliximab | Biologic Licensing Application | 2025-06-03 |
progest-oil-2oz-sb | unapproved drug other | 2025-06-01 |
remicade | Biologic Licensing Application | 2025-06-03 |
renflexis | Biologic Licensing Application | 2024-01-03 |
zymfentra | Biologic Licensing Application | 2025-05-28 |
Expiration | Code | ||
---|---|---|---|
infliximab, Remicade, Janssen Biotech, Inc. | |||
2118-09-23 | Orphan excl. |
Code | Description |
---|---|
EJ | Subsequent claims for a defined course of therapy, e.g., epo, sodium hyaluronate, infliximab |
J1745 | Injection, infliximab, excludes biosimilar, 10 mg |
Q5103 | Injection, infliximab-dyyb, biosimilar, (inflectra), 10 mg |
Q5104 | Injection, infliximab-abda, biosimilar, (renflexis), 10 mg |
Q5109 | Injection, infliximab-qbtx, biosimilar, (ixifi), 10 mg |
Q5121 | Injection, infliximab-axxq, biosimilar, (avsola), 10 mg |
S9359 | Home infusion therapy, anti-tumor necrosis factor intravenous therapy; (e.g., infliximab); administrative services, professional pharmacy services, care coordination, and all necessary supplies and equipment (drugs and nursing visits coded separately), per diem |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Psoriasis | D011565 | EFO_0000676 | L40 | — | — | — | 1 | 2 | 3 |
Arthritis | D001168 | EFO_0005856 | M05-M14 | — | — | 1 | 1 | 1 | 3 |
Rheumatoid arthritis | D001172 | EFO_0000685 | M06.9 | — | — | 1 | 1 | — | 2 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Chronic renal insufficiency | D051436 | — | N18 | — | 1 | 2 | — | — | 3 |
Kidney diseases | D007674 | EFO_0003086 | N08 | — | 1 | 2 | — | — | 3 |
Neoplasm metastasis | D009362 | EFO_0009708 | — | — | 1 | 2 | — | — | 3 |
Hyperparathyroidism | D006961 | EFO_0008506 | E21.3 | — | 1 | 2 | — | — | 3 |
Secondary hyperparathyroidism | D006962 | EFO_1001173 | — | — | 1 | 2 | — | — | 3 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Psoriatic arthritis | D015535 | EFO_0003778 | L40.5 | — | — | — | — | 1 | 1 |
Drug common name | Infliximab |
INN | infliximab |
Description | Infliximab, a chimeric monoclonal antibody, sold under the brand name Remicade among others, is a medication used to treat a number of autoimmune diseases. This includes Crohn's disease, ulcerative colitis, rheumatoid arthritis, ankylosing spondylitis, psoriasis, psoriatic arthritis, and Behçet's disease. It is given by slow injection into a vein, typically at six- to eight-week intervals.
|
Classification | Antibody |
Drug class | monoclonal antibodies |
Image (chem structure or protein) | ![]() |
Structure (InChI/SMILES or Protein Sequence) | >6UGS:H,A|Infliximab (Remicade) Fab Heavy Chain
EVKLEESGGGLVQPGGSMKLSCVASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTISRDDSKSA
VYLQMTDLRTEDTGVYYCSRNYYGSTYDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT
>6UGS:L,B|Infliximab (Remicade) Fab Light Chain
DILLTQSPAILSVSPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKYASESMSGIPSRFSGSGSGTDFTLSINTVES
EDIADYYCQQSHSWPFTFGSGTNLEVKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |