
Tradename | Proper name | Company | Number | Date | Products |
|---|---|---|---|---|---|
| Zymfentra | infliximab-dyyb | Celltrion | N-761358 RX | 2023-10-20 | 2 products |
| Remicade | infliximab | Johnson & Johnson | N-103772 RX | 1998-08-24 | 1 products |
Brand Name | Status | Last Update |
|---|---|---|
| avsola | Biologic Licensing Application | 2026-07-22 |
| ca22 benzoyl peroxide cleansing | OTC monograph final | 2022-12-08 |
| inflectra | Biologic Licensing Application | 2026-07-28 |
| infliximab | Biologic Licensing Application | 2026-02-11 |
| remicade | Biologic Licensing Application | 2025-06-03 |
| renflexis | Biologic Licensing Application | 2025-11-05 |
| zymfentra | Biologic Licensing Application | 2025-05-28 |
Expiration | Code | ||
|---|---|---|---|
infliximab, Remicade, Janssen Biotech, Inc. | |||
| 2118-09-23 | Orphan excl. | ||
Code | Description |
|---|---|
| EJ | Subsequent claims for a defined course of therapy, e.g., epo, sodium hyaluronate, infliximab |
| J1745 | Injection, infliximab, excludes biosimilar, 10 mg |
| Q5103 | Injection, infliximab-dyyb, biosimilar, (inflectra), 10 mg |
| Q5104 | Injection, infliximab-abda, biosimilar, (renflexis), 10 mg |
| Q5109 | Injection, infliximab-qbtx, biosimilar, (ixifi), 10 mg |
| Q5121 | Injection, infliximab-axxq, biosimilar, (avsola), 10 mg |
| S9359 | Home infusion therapy, anti-tumor necrosis factor intravenous therapy; (e.g., infliximab); administrative services, professional pharmacy services, care coordination, and all necessary supplies and equipment (drugs and nursing visits coded separately), per diem |

Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Crohn disease | D003424 | EFO_0000384 | K50 | — | 1 | 2 | 1 | 4 | 7 |
| Ulcerative colitis | D003093 | EFO_0000729 | K51 | — | — | 1 | 1 | 4 | 6 |
| Inflammatory bowel diseases | D015212 | EFO_0003767 | — | — | — | 1 | 2 | 2 | 5 |
| Lymphoma | D008223 | — | C85.9 | — | — | — | 1 | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Rheumatoid arthritis | D001172 | EFO_0000685 | M06.9 | — | — | 2 | — | 3 | 5 |
| Arthritis | D001168 | EFO_0005856 | M05-M14 | — | — | 2 | — | 2 | 4 |
| Autoimmune diseases | D001327 | EFO_0000540 | M30-M36 | — | — | 1 | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Cytokine release syndrome | D000080424 | — | D89.83 | — | 1 | — | — | — | 1 |
| Multiple myeloma | D009101 | — | C90.0 | — | 1 | — | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Ankylosing spondylitis | D013167 | EFO_0003898 | M45 | — | — | — | — | 3 | 3 |
| Psoriatic arthritis | D015535 | EFO_0003778 | L40.5 | — | — | — | — | 3 | 3 |
| Psoriasis | D011565 | EFO_0000676 | L40 | — | — | — | — | 2 | 2 |
| Spondylitis | D013166 | — | M46.9 | — | — | — | — | 2 | 2 |
| Skin diseases | D012871 | — | L00-L99 | — | — | — | — | 1 | 1 |
| Alzheimer disease | D000544 | EFO_0000249 | F03 | — | — | — | — | 1 | 1 |
| Dementia | D003704 | EFO_0003862 | F03 | — | — | — | — | 1 | 1 |
| Spondylarthritis | D025241 | — | — | — | — | — | — | 1 | 1 |
| Intestinal diseases | D007410 | — | K63.9 | — | — | — | — | 1 | 1 |
| Colitis | D003092 | EFO_0003872 | K52.9 | — | — | — | — | 1 | 1 |
| Drug common name | Infliximab |
| INN | infliximab |
| Description | Infliximab, a chimeric monoclonal antibody, sold under the brand name Remicade among others, is a medication used to treat a number of autoimmune diseases. This includes Crohn's disease, ulcerative colitis, rheumatoid arthritis, ankylosing spondylitis, psoriasis, psoriatic arthritis, and Behçet's disease. It is given by slow injection into a vein, typically at six- to eight-week intervals.
|
| Classification | Antibody |
| Drug class | monoclonal antibodies |
| Image (chem structure or protein) | ![]() |
| Structure (InChI/SMILES or Protein Sequence) | >6UGS:H,A|Infliximab (Remicade) Fab Heavy Chain
EVKLEESGGGLVQPGGSMKLSCVASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTISRDDSKSA
VYLQMTDLRTEDTGVYYCSRNYYGSTYDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT
>6UGS:L,B|Infliximab (Remicade) Fab Light Chain
DILLTQSPAILSVSPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKYASESMSGIPSRFSGSGSGTDFTLSINTVES
EDIADYYCQQSHSWPFTFGSGTNLEVKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |
















