Remicade(infliximab)
Avsola, Flixabi, Inflectra, Remicade, Remsima, Renflexis, Zessly, Zymfentra (infliximab) is an antibody pharmaceutical. Infliximab was first approved as Remicade on 1998-08-24. It is used to treat ankylosing spondylitis, crohn disease, psoriatic arthritis, rheumatoid arthritis, and ulcerative colitis in the USA. It has been approved in Europe to treat ankylosing spondylitis, crohn disease, psoriasis, psoriatic arthritis, and rheumatoid arthritis amongst others. The pharmaceutical is active against tumor necrosis factor.
Download report
Favorite
Events Timeline
Commercial
Clinical
Drug
Target
Variants
Financial
Trends
Safety
Events Timeline
5D
1M
3M
6M
YTD
1Y
2Y
5Y
Max
Events
FDA approval date
EMA approval date
Patent expiration date
Study first post date
Last update post date
Start date
Primary completion date
Completion date
Results first post date
Mock data
Subscribe for the real data
Subscribe for the real data
Commercial
Therapeutic Areas
Trade Name
FDA
EMA
Avsola, Inflectra, Remicade, Renflexis (discontinued: Ixifi)
Drug Products
FDA
EMA
Reference product - 351(a)
Reference product - 351(a)
Interchangeable product - 351(k)
Interchangeable product - 351(k)
Biosimilar product - 351(k)
Biosimilar product - 351(k)
Infliximab
Tradename | Proper name | Company | Number | Date | Products |
|---|---|---|---|---|---|
| Remicade | infliximab | Johnson & Johnson | N-103772 RX | 1998-08-24 | 1 products |
Agency Specific
FDA
EMA
Expiration | Code | ||
|---|---|---|---|
infliximab, Remicade, Janssen Biotech, Inc. | |||
| 2118-09-23 | Orphan excl. | ||
Patent Expiration
No data
HCPCS
Code | Description |
|---|---|
| EJ | Subsequent claims for a defined course of therapy, e.g., epo, sodium hyaluronate, infliximab |
| J1745 | Injection, infliximab, excludes biosimilar, 10 mg |
| Q5103 | Injection, infliximab-dyyb, biosimilar, (inflectra), 10 mg |
| Q5104 | Injection, infliximab-abda, biosimilar, (renflexis), 10 mg |
| Q5109 | Injection, infliximab-qbtx, biosimilar, (ixifi), 10 mg |
| Q5121 | Injection, infliximab-axxq, biosimilar, (avsola), 10 mg |
| S9359 | Home infusion therapy, anti-tumor necrosis factor intravenous therapy; (e.g., infliximab); administrative services, professional pharmacy services, care coordination, and all necessary supplies and equipment (drugs and nursing visits coded separately), per diem |
Clinical
Clinical Trials
578 clinical trials
View more details
Mock data
Subscribe for the real data
Subscribe for the real data
Indications Phases 4
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Crohn disease | D003424 | EFO_0000384 | K50 | 2 | 7 | 29 | 34 | 78 | 146 |
| Rheumatoid arthritis | D001172 | EFO_0000685 | M06.9 | 2 | 4 | 29 | 29 | 56 | 120 |
| Ulcerative colitis | D003093 | EFO_0000729 | K51 | 3 | 3 | 11 | 22 | 53 | 91 |
| Inflammatory bowel diseases | D015212 | EFO_0003767 | — | 2 | 3 | 3 | 11 | 55 | 73 |
| Psoriasis | D011565 | EFO_0000676 | L40 | — | 2 | 11 | 7 | 21 | 41 |
| Ankylosing spondylitis | D013167 | EFO_0003898 | M45 | 3 | — | 5 | 11 | 22 | 41 |
| Psoriatic arthritis | D015535 | EFO_0003778 | L40.5 | — | — | 4 | 5 | 15 | 24 |
| Covid-19 | D000086382 | — | U07.1 | — | 2 | 2 | 2 | 2 | 8 |
| Spondylarthritis | D025241 | — | — | — | — | — | 2 | 5 | 7 |
| Graft vs host disease | D006086 | — | D89.81 | 1 | 3 | 1 | 1 | — | 6 |
Show 16 more
Indications Phases 3
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Mucocutaneous lymph node syndrome | D009080 | EFO_0004246 | M30.3 | 1 | 1 | 6 | — | — | 8 |
| Colitis | D003092 | EFO_0003872 | K52.9 | 2 | 4 | 1 | — | 1 | 6 |
| Juvenile arthritis | D001171 | EFO_1002007 | M08 | — | 1 | 2 | — | 2 | 5 |
| Fatigue | D005221 | HP_0012378 | R53.83 | — | 1 | 1 | — | 2 | 4 |
| Behcet syndrome | D001528 | EFO_0003780 | M35.2 | 1 | 1 | 3 | — | — | 4 |
| Sarcoidosis | D012507 | EFO_0000690 | D80-D89 | — | — | 2 | — | 2 | 4 |
| Vasculitis | D014657 | HP_0002633 | — | 1 | 2 | 1 | — | — | 3 |
| Lung neoplasms | D008175 | HP_0100526 | C34.90 | 1 | 2 | 1 | — | — | 3 |
| Cachexia | D002100 | HP_0004326 | R64 | — | 2 | 1 | — | — | 3 |
| Chronic obstructive pulmonary disease | D029424 | EFO_0000341 | J44.9 | — | 1 | 1 | — | 1 | 3 |
Show 14 more
Indications Phases 2
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Melanoma | D008545 | — | — | 2 | 4 | — | — | 1 | 6 |
| Takayasu arteritis | D013625 | EFO_1001857 | M31.4 | — | 3 | — | — | 1 | 4 |
| Stevens-johnson syndrome | D013262 | EFO_0004276 | L51.1 | 2 | 3 | — | — | — | 3 |
| Macular degeneration | D008268 | EFO_0001365 | H35.30 | 1 | 1 | — | — | — | 2 |
| Vitamin d deficiency | D014808 | EFO_0003762 | E55 | — | 1 | — | — | 1 | 2 |
| Non-small-cell lung carcinoma | D002289 | — | — | 2 | 2 | — | — | — | 2 |
| Reperfusion injury | D015427 | — | — | 1 | 1 | — | — | — | 2 |
| Type 1 diabetes mellitus | D003922 | EFO_0001359 | E10 | — | 1 | — | — | 1 | 2 |
| Inflammation | D007249 | MP_0001845 | — | 1 | 2 | — | — | — | 2 |
| Hidradenitis suppurativa | D017497 | — | L73.2 | 1 | 1 | — | — | — | 2 |
Show 41 more
Indications Phases 1
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Healthy volunteers/patients | — | — | — | 3 | — | — | — | — | 3 |
| Scleritis | D015423 | HP_0100534 | H15.0 | 1 | — | — | — | 1 | 2 |
| Energy metabolism | D004734 | — | — | 1 | — | — | — | 1 | 2 |
Indications Without Phase
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Rheumatic diseases | D012216 | — | M79.0 | — | — | — | — | 2 | 2 |
| Atopic dermatitis | D003876 | EFO_0000274 | L20 | — | — | — | — | 2 | 2 |
| Intestinal diseases | D007410 | HP_0002242 | K63.9 | — | — | — | — | 2 | 2 |
| Pain | D010146 | EFO_0003843 | R52 | — | — | — | — | 1 | 1 |
| Brain diseases | D001927 | HP_0001298 | G93.40 | — | — | — | — | 1 | 1 |
| Cognitive dysfunction | D060825 | HP_0001268 | G31.84 | — | — | — | — | 1 | 1 |
| Alzheimer disease | D000544 | EFO_0000249 | F03 | — | — | — | — | 1 | 1 |
| Dementia | D003704 | EFO_0003862 | F03 | — | — | — | — | 1 | 1 |
| Infections | D007239 | EFO_0000544 | — | — | — | — | — | 1 | 1 |
| Lactation | D007774 | — | — | — | — | — | — | 1 | 1 |
Show 21 more
Epidemiology
Epidemiological information for investigational and approved indications
View more details
Drug
General
| Drug common name | Infliximab |
| INN | infliximab |
| Description | Infliximab, a chimeric monoclonal antibody, sold under the brand name Remicade among others, is a medication used to treat a number of autoimmune diseases. This includes Crohn's disease, ulcerative colitis, rheumatoid arthritis, ankylosing spondylitis, psoriasis, psoriatic arthritis, and Behçet's disease. It is given by slow injection into a vein, typically at six- to eight-week intervals.
|
| Classification | Antibody |
| Drug class | monoclonal antibodies |
| Image (chem structure or protein) |  |
| Structure (InChI/SMILES or Protein Sequence) | >6UGS:H,A|Infliximab (Remicade) Fab Heavy Chain
EVKLEESGGGLVQPGGSMKLSCVASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTISRDDSKSA
VYLQMTDLRTEDTGVYYCSRNYYGSTYDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT
>6UGS:L,B|Infliximab (Remicade) Fab Light Chain
DILLTQSPAILSVSPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKYASESMSGIPSRFSGSGSGTDFTLSINTVES
EDIADYYCQQSHSWPFTFGSGTNLEVKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |
Target
Agency Approved
TNF
TNF
Organism
Homo sapiens
Gene name
TNF
Gene synonyms
TNFA, TNFSF2
NCBI Gene ID
Protein name
tumor necrosis factor
Protein synonyms
APC1 protein, Cachectin, TNF, macrophage-derived, TNF, monocyte-derived, TNF-a, TNF-alpha, tumor necrosis factor ligand 1F, Tumor necrosis factor ligand superfamily member 2, tumor necrosis factor-alpha, tumor necrotic factor alpha
Uniprot ID
Mouse ortholog
Tnf (21926)
tumor necrosis factor (P06804)
Alternate
No data
Variants
No data
Financial
Revenue by drug
$
€
£
₣
Remicade – Johnson & Johnson
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Remicade – Merck Sharp & Dohme
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Flixabi – Biogen
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Renflexis – Organon
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Inflectra – Pfizer
Mock data
Subscribe for the real data
Subscribe for the real data
Mock data
Subscribe for the real data
Subscribe for the real data
Tabular view
Estimated US medical usage
Infliximab
Total medical expenditures per year (USD, in millions)
Mock data
Subscribe for the real data
Subscribe for the real data
Number of persons purchased
Mock data
Subscribe for the real data
Subscribe for the real data
Number of purchases
Mock data
Subscribe for the real data
Subscribe for the real data
Refill frequency
Mock data
Subscribe for the real data
Subscribe for the real data
Price per prescription (USD)
Mock data
Subscribe for the real data
Subscribe for the real data
Tabular view
Trends
PubMed Central
Top Terms for Disease or Syndrome:
Mock data
Subscribe for the real data
Subscribe for the real data
Additional graphs summarizing 43,204 documents
View more details
Safety
Black-box Warning
Black-box warning for: Avsola, Inflectra, Remicade, Renflexis
Adverse Events
Top Adverse Reactions
Mock data
Subscribe for the real data
Subscribe for the real data
187,706 adverse events reported
View more details
© 2020-2023 Collaborative Drug Discovery Inc. (CDD) | Terms of Use