

Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Iron-deficiency anemia | D018798 | — | D50 | — | — | — | 2 | — | 2 |
| Iron deficiencies | D000090463 | — | E61.1 | — | — | — | 2 | — | 2 |
| Anemia | D000740 | EFO_0004272 | D64.9 | — | — | — | 1 | — | 1 |
| Neoplasm metastasis | D009362 | EFO_0009708 | — | — | — | — | 1 | — | 1 |
| Inflammatory bowel diseases | D015212 | EFO_0003767 | — | — | — | — | 1 | — | 1 |
| Deficiency diseases | D003677 | EFO_1001067 | E63 | — | — | — | 1 | — | 1 |
| Drug common name | Hepcidin |
| INN | hepcidin |
| Description | Hepcidin is a protein that in humans is encoded by the HAMP gene. Hepcidin is a key regulator of the entry of iron into the circulation in mammals.
|
| Classification | Protein |
| Drug class | natural antibiotics (undefined group) |
| Image (chem structure or protein) | ![]() |
| Structure (InChI/SMILES or Protein Sequence) | >3H0T:A|Fab fragment, Light chain
NFMLTQPHSVSESPGKTVTISCTRSSGSIASYYVQWYQQRPGSSPTTVIYEDSQRPSGVPDRFSGSIDSSSNSASLTISG
LKTEDEADYYCQSYDSSNVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVK
AGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
>3H0T:B|Fab fragment, Heavy chain
QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWFNDYAVSVQSRITINPDTSKN
QFSLQLNSVTPEDTAVYYCARGIVFSYAMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCAADEVDHHHHHH |
