PharmaKB logo
Company Reports
Company Reports
Drug Reports
Drug Reports
Disease Reports
Disease Reports
AboutPricing
Drug ReportsHepcidin
Hepcidin
Hepcidin is a protein pharmaceutical. It is currently being investigated in clinical studies.
Download report
Favorite
Events Timeline
Commercial
Clinical
Drug
Target
Variants
Financial
Trends
Safety
Events Timeline
5D
1M
3M
6M
YTD
1Y
2Y
5Y
Max
Events
FDA approval date
EMA approval date
Patent expiration date
Study first post date
Last update post date
Start date
Primary completion date
Completion date
Results first post date
Plot placeholder
Mock data
Subscribe for the real data
Commercial
No data
Clinical
Clinical Trials
105 clinical trials
View more details
Plot placeholder
Mock data
Subscribe for the real data
Indications Phases 4
Indication
MeSH
Ontology
ICD-10
Ph 1
Ph 2
Ph 3
Ph 4
Other
Total
Iron-deficiency anemiaD018798—D50———2—2
Iron deficienciesD000090463—E61.1———2—2
AnemiaD000740EFO_0004272D64.9———1—1
Neoplasm metastasisD009362EFO_0009708————1—1
Inflammatory bowel diseasesD015212EFO_0003767————1—1
Deficiency diseasesD003677EFO_1001067E63———1—1
Indications Phases 3
No data
Indications Phases 2
No data
Indications Phases 1
No data
Indications Without Phase
No data
Epidemiology
Epidemiological information for investigational and approved indications
View more details
Drug
General
Drug common nameHepcidin
INNhepcidin
Description
Hepcidin is a protein that in humans is encoded by the HAMP gene. Hepcidin is a key regulator of the entry of iron into the circulation in mammals.
Classification
Protein
Drug classnatural antibiotics (undefined group)
Image (chem structure or protein)Loading
Structure (InChI/SMILES or Protein Sequence)
>3H0T:A|Fab fragment, Light chain NFMLTQPHSVSESPGKTVTISCTRSSGSIASYYVQWYQQRPGSSPTTVIYEDSQRPSGVPDRFSGSIDSSSNSASLTISG LKTEDEADYYCQSYDSSNVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVK AGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS >3H0T:B|Fab fragment, Heavy chain QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWFNDYAVSVQSRITINPDTSKN QFSLQLNSVTPEDTAVYYCARGIVFSYAMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCAADEVDHHHHHH
Identifiers
PDB1M4E, 1M4F, 1S6W, 2KEF, 3H0T, 4QAE, 6WBV, 6WIK
CAS-ID—
RxCUI—
ChEMBL IDCHEMBL4594323
ChEBI ID—
PubChem CID—
DrugBank—
UNII IDXUH21YGS7O (ChemIDplus, GSRS)
Target
No data
Variants
No data
Financial
No data
Trends
PubMed Central
Top Terms for Disease or Syndrome:
Plot placeholder
Mock data
Subscribe for the real data
Additional graphs summarizing 19,003 documents
View more details
Safety
Black-box Warning
No Black-box warning
Adverse Events
0 adverse events reported
© 2020-2025 Collaborative Drug Discovery Inc. (CDD) | Terms of Use