
Brand Name | Status | Last Update |
|---|---|---|
| alymsys | Biologic Licensing Application | 2026-03-23 |
| avastin | Biologic Licensing Application | 2025-01-06 |
| jobevne | Biologic Licensing Application | 2025-04-01 |
| mvasi | Biologic Licensing Application | 2026-06-23 |
| vegzelma | Biologic Licensing Application | 2025-05-08 |
| zirabev | Biologic Licensing Application | 2025-08-05 |
Expiration | Code | ||
|---|---|---|---|
bevacizumab, Avastin, Genentech, Inc. | |||
| 2027-05-29 | Orphan excl. | ||

Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Non-small-cell lung carcinoma | D002289 | — | — | — | — | 1 | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Healthy volunteers/patients | — | — | — | 1 | — | — | — | — | 1 |
| Drug common name | Bevacizumab |
| INN | bevacizumab |
| Description | Bevacizumab, sold under the brand name Avastin, is a medication used to treat a number of types of cancers and a specific eye disease. For cancer it is given by slow injection into a vein and used for colon cancer, lung cancer, glioblastoma, and renal-cell carcinoma. For age-related macular degeneration it is given by injection into the eye.
|
| Classification | Antibody |
| Drug class | monoclonal antibodies |
| Image (chem structure or protein) | ![]() |
| Structure (InChI/SMILES or Protein Sequence) | >7V5N:A,E|bevacizumab fab light chain
DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>7V5N:B,F|bevacizumab fab heavy chain
EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTYAADFKRRFTFSLDTSKSTAY
LQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT |
| PDB | 6BFT, 7V5N |
| CAS-ID | — |
| RxCUI | — |
| ChEMBL ID | CHEMBL1201583 |
| ChEBI ID | — |
| PubChem CID | — |
| DrugBank | DB00112 |
| UNII ID | 2S9ZZM9Q9V (ChemIDplus, GSRS) |

