Therapeutic Area | MeSH |
---|---|
cardiovascular diseases | D002318 |
signs and symptoms pathological conditions | D013568 |
Tradename | Proper name | Company | Number | Date | Products |
---|---|---|---|---|---|
Reopro | abciximab | Johnson & Johnson | N-103575 DISCN | 1994-12-22 | 1 products |
Indication | Ontology | MeSH | ICD-10 |
---|---|---|---|
unstable angina | EFO_1000985 | D000789 | I20.0 |
Code | Description |
---|---|
G9531 | Patient has documentation of ventricular shunt, brain tumor, multisystem trauma, or is currently taking an antiplatelet medication including: abciximab, anagrelide, cangrelor, cilostazol, clopidogrel, dipyridamole, eptifibatide, prasugrel, ticlopidine, ticagrelor, tirofiban, or vorapaxar |
J0130 | Injection abciximab, 10 mg |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Renal artery obstruction | D012078 | EFO_1001150 | N28.0 | — | 1 | — | — | — | 1 |
Drug common name | Abciximab |
INN | abciximab |
Description | Abciximab (chimeric Fab) |
Classification | Antibody |
Drug class | monoclonal antibodies |
Image (chem structure or protein) | ![]() |
Structure (InChI/SMILES or Protein Sequence) | >6V4P:C|Abciximab, heavy chain
EVQLQQSGTVLARPGASVKMSCEASGYTFTNYWMHWVKQRPGQGLEWIGAIYPGNSDTSYIQKFKGKAKLTAVTSTTSVY
MELSSLTNEDSAVYYCTLYDGYYVFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH
>6V4P:D|Abciximab, light chain
EIVLTQSPVTLSVTPGDSVSLSCRASRDISNNLHWFQQTSHESPRLLIKYASQSMSGIPSRFSGSGSGTDFTLSINSVET
EDFGMYFCQQTNSWPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |
PDB | 6V4P |
CAS-ID | — |
RxCUI | — |
ChEMBL ID | CHEMBL1201584 |
ChEBI ID | — |
PubChem CID | — |
DrugBank | DB00054 |
UNII ID | X85G7936GV (ChemIDplus, GSRS) |