Therapeutic Area | MeSH |
---|---|
cardiovascular diseases | D002318 |
signs and symptoms pathological conditions | D013568 |
Tradename | Proper name | Company | Number | Date | Products |
---|---|---|---|---|---|
Reopro | abciximab | Johnson & Johnson | N-103575 DISCN | 1994-12-22 | 1 products |
Indication | Ontology | MeSH | ICD-10 |
---|---|---|---|
unstable angina | EFO_1000985 | D000789 | I20.0 |
Code | Description |
---|---|
G9531 | Patient has documentation of ventricular shunt, brain tumor, multisystem trauma, or is currently taking an antiplatelet medication including: abciximab, anagrelide, cangrelor, cilostazol, clopidogrel, dipyridamole, eptifibatide, prasugrel, ticlopidine, ticagrelor, tirofiban, or vorapaxar |
J0130 | Injection abciximab, 10 mg |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Infarction | D007238 | EFO_0009463 | — | — | 6 | 9 | 20 | 7 | 40 |
Myocardial infarction | D009203 | EFO_0000612 | I21 | — | 6 | 9 | 19 | 7 | 39 |
Inferior wall myocardial infarction | D056989 | EFO_1000983 | — | — | 3 | 1 | 4 | 2 | 10 |
St elevation myocardial infarction | D000072657 | — | — | — | — | 3 | 2 | 4 | 9 |
Acute coronary syndrome | D054058 | EFO_0005672 | — | — | — | 2 | 1 | 2 | 5 |
Coronary artery disease | D003324 | — | I25.1 | — | — | — | 2 | 3 | 5 |
Unstable angina | D000789 | EFO_1000985 | I20.0 | — | 1 | 2 | 1 | — | 4 |
Coronary disease | D003327 | — | — | — | — | — | 4 | — | 4 |
Angina pectoris | D000787 | EFO_0003913 | I20 | — | 1 | 1 | 1 | — | 3 |
Syndrome | D013577 | — | — | — | — | 1 | 1 | 1 | 3 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Stroke | D020521 | EFO_0000712 | I63.9 | — | 2 | 3 | — | — | 5 |
Balloon angioplasty coronary | D015906 | EFO_0003951 | — | — | — | 4 | — | — | 4 |
Carotid stenosis | D016893 | — | — | 1 | 1 | 1 | — | — | 2 |
Ischemic stroke | D000083242 | — | — | — | — | 2 | — | — | 2 |
Recurrence | D012008 | — | — | — | — | 1 | — | — | 1 |
Pathologic constriction | D003251 | — | — | — | — | 1 | — | — | 1 |
Non-st elevated myocardial infarction | D000072658 | — | — | — | — | 1 | — | — | 1 |
Peripheral arterial disease | D058729 | EFO_0004265 | — | — | 1 | 1 | — | — | 1 |
Arterial occlusive diseases | D001157 | EFO_0009085 | — | — | 1 | 1 | — | — | 1 |
Peripheral vascular diseases | D016491 | EFO_0003875 | I73.9 | — | 1 | 1 | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Stable angina | D060050 | — | I20.89 | — | 2 | — | — | — | 2 |
Sickle cell anemia | D000755 | EFO_0000697 | D57 | — | 1 | — | — | — | 1 |
Renal artery obstruction | D012078 | EFO_1001150 | N28.0 | — | 1 | — | — | — | 1 |
Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
---|---|---|---|---|---|---|---|---|---|
Anterior wall myocardial infarction | D056988 | EFO_1000812 | — | — | — | — | — | 2 | 2 |
Myocardial ischemia | D017202 | EFO_1001375 | I20-I25 | — | — | — | — | 1 | 1 |
Heart diseases | D006331 | EFO_0003777 | I51.9 | — | — | — | — | 1 | 1 |
Atherosclerosis | D050197 | EFO_0003914 | I25.1 | — | — | — | — | 1 | 1 |
Drug common name | Abciximab |
INN | abciximab |
Description | Abciximab (chimeric Fab) |
Classification | Antibody |
Drug class | monoclonal antibodies |
Image (chem structure or protein) | ![]() |
Structure (InChI/SMILES or Protein Sequence) | >6V4P:C|Abciximab, heavy chain
EVQLQQSGTVLARPGASVKMSCEASGYTFTNYWMHWVKQRPGQGLEWIGAIYPGNSDTSYIQKFKGKAKLTAVTSTTSVY
MELSSLTNEDSAVYYCTLYDGYYVFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH
>6V4P:D|Abciximab, light chain
EIVLTQSPVTLSVTPGDSVSLSCRASRDISNNLHWFQQTSHESPRLLIKYASQSMSGIPSRFSGSGSGTDFTLSINSVET
EDFGMYFCQQTNSWPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |
PDB | 6V4P |
CAS-ID | — |
RxCUI | — |
ChEMBL ID | CHEMBL1201584 |
ChEBI ID | — |
PubChem CID | — |
DrugBank | DB00054 |
UNII ID | X85G7936GV (ChemIDplus, GSRS) |